KEGG   Chroococcidiopsis thermalis: Chro_1640Help
Entry
Chro_1640         CDS       T02360                                 

Definition
cobaltochelatase (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cthe00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1825240..1829226
Genome map
AA seq 1328 aa AA seqDB search
MFTHVKSTIRHITPDNLAERALIKVVYVVLESQYQSALSQAVRQINQSNPNLAIEISGYL
IEELRDPENYEEFKRDIQSADIFIASLIFIEDLAQKVVAAVEPYRDRLDVAVVFPSMPEV
MRLNKMGSFSMAQLGQSKSAIAQFMRKRKEKSGASFQDGMLKLLQTLPKVLKYLPIDKAQ
DARNFMLSFQYWLGGSPENLQNFLLMLADKYVLNGVETLHATSLQYREPVVYPDMGIWHP
LSTTMFEDVKEYLNWHNSRQDISSDLKDPLAPCVGLVLQRTHLVTGDDAHYVAIVQELEA
MGARVVPVFAGGLDFSKPVDAYFYDPVSKNPIVDTAISLTGFALVGGPARQDHPKAIEAL
KRLNRPYMVALPLVFQTTEEWQDSDLGLHPIQVALQIAIPELDGAIEPIILSGRDGATGK
AIALQDRIEAVAQRAMKWANLRRKPKLDKKVAITVFSFPPDKGNVGTAAYLDVFGSIYEV
MQALRNNGYDVQDLPESPKELMEQVIHDAQAQYSSPELNVAYRMSVPEYEALTPYSQKLE
ENWGPPPGHLNSDGQNLLVYGKQFGNVFIGVQPTFGYEGDPMRLLFSRSASPHHGFAAYY
TYLEQIWQADAVLHFGTHGSLEFMPGKQMGMSGDCYPDNLIGMIPNLYYYAANNPSEATI
AKRRSYAETISYLTPPAENAGLYKGLKELSELIGSYQTLKDSGRGIPIVNTIMDKCRMVN
LDQDINLPQQDAKDMTAEERDNIVGLVYRKLMEIESRLLPCGLHVIGKPPSAEEAIATLV
NIAGLDRAEEEIQSLPRIIANSVGRDIDEIYHNSDRGVLEDVQLLQDITLASRAAVSALV
QAQTDAEGRVSLVSKLNFFNMGKKEPWVEALHQAGYAKVDPNALKPLFEYLEFCLQQVCA
DNELGALLRGLEGEYILPGPGGDPIRNPDVLPTGKNIHALDPQAIPTMAAVRSAKIVVDR
LLDRNKAENGGKFPETIACVLWGTDNIKTYGESLAQIMWMVGVRPVPDALGRVNKLELIP
LEELGRPRIDVVINCSGVFRDLFINQMNLLDQAVKMAAEADEPVEMNFVRKHALKQAEDM
GINLRQAATRVFSNASGSYSSNINLAVENSTWDSEAELQEMYLKRKSFAFSADNPGTMEQ
SRQIFETTLKTAEVTFQNLDSSEISLTDVSHYYDSDPTKVVASLRNDGKMPTSYMADTTT
ANAQVRTLSETVRLDSRTKLLNPKWYEGMLSHGYEGVRELSKRLVNTMGWSATAGAVDNW
IYEDANDTFIKDEAMRQRLLNLNPHSFRKMVSTLLEANGRGYWDTDENNLDLLRELYQEV
EDRIEGIE
NT seq 3987 nt NT seq  +upstreamnt  +downstreamnt
atgttcacacacgtcaagtccaccatccgacacattacgcccgacaacctggcagaacgt
gctttaatcaaggtggtctatgtcgtgctagagtcccagtatcagagcgccttatcgcaa
gcggtacgccaaattaaccaaagcaatccgaatttggcgatcgaaattagcggctatctg
atcgaagaactccgagaccctgaaaactacgaggagttcaagcgcgatatccaaagtgcc
gacatcttcatcgcctcactgatttttattgaagacttggcgcaaaaggtggtagcggca
gtagaaccataccgcgatcgcttggatgtggctgttgtcttcccctcaatgccagaggtg
atgcgcctcaataaaatgggtagcttctcgatggcgcagttgggacaatccaaaagcgcg
atcgcccaattcatgcgcaagcgtaaagaaaaatctggggcttctttccaagacgggatg
ctgaagctactccaaaccttgcccaaggtactgaagtatttgcccatcgacaaagcccaa
gatgcgcgtaacttcatgttgagttttcagtattggttgggggggtcgccagaaaacctg
caaaatttcttgctgatgttggcggataaatacgtgttgaatggtgtagagacgttgcac
gccacgtctctacaataccgggaacccgtagtttatcccgacatgggtatttggcatcct
ttgtcaaccactatgtttgaggatgtcaaggaatacctcaactggcacaacagccgccaa
gatatctctagcgacctaaaagacccgcttgcgccttgcgtgggactcgtactgcaacgc
acccacctagtaacgggggatgatgcccattacgtagcaatcgtgcaggaactcgaagca
atgggggcgcgagtggttcctgtgtttgcgggtggtttggacttttccaagcccgtcgat
gcttatttctacgatccagttagtaaaaatccgatcgtagatacggcgatctccctaacg
ggttttgccttggtaggaggacctgcacgacaggatcatcccaaagcaattgaagcactg
aagcggctgaaccgcccttacatggttgccctgcctttagtgtttcagacgacggaggag
tggcaagatagcgatctaggcttgcacccaattcaagtggcactacaaattgccattcca
gaattggatggggcgatcgagccgattatactatcaggtcgagacggtgcgacaggtaaa
gcgatcgccctgcaagaccgaattgaagccgttgcccaacgtgcgatgaaatgggcaaac
ctgcgccgcaagccgaaacttgacaaaaaagtggcgattaccgttttcagtttcccgcct
gataaaggtaatgtggggacagccgcctacttggatgtattcggttccatttacgaggtg
atgcaagccctgcgaaataacggctacgacgtgcaggatttgccagagtcgcccaaagag
ttgatggaacaggtgatccacgatgcccaagcgcagtacagcagccccgaactcaatgtt
gcttaccggatgtccgtaccggaatacgaagcactgactccctattcgcaaaaattagag
gaaaactggggaccaccaccagggcatctcaacagcgacgggcagaaccttttggtatac
ggcaagcaattcggtaatgtttttattggcgtacagccgacattcggctatgaaggcgac
ccgatgcggttgttgttctctcgttctgccagtccccatcacggttttgcggcttactac
acatatttagagcaaatttggcaagctgatgcggtgttgcacttcgggacgcacggttcc
ttggaattcatgccaggaaagcaaatggggatgtcgggtgactgctacccagataattta
attggcatgattcccaacttgtactattacgcagcaaataaccccagtgaagccacaatt
gccaaacgccgcagctacgccgagacgatttcctacttgacaccaccagccgaaaatgct
ggattgtacaagggtttgaaggaattaagcgaactaattggttcttatcaaactttaaaa
gattccggtcgcggtatccccattgtcaacaccatcatggataagtgccggatggtaaat
ttagaccaagatattaacttgccccagcaagatgccaaagatatgactgctgaggagcga
gataatattgttggcttggtgtatcgcaagttgatggaaattgagtcgcggttgttgcct
tgcgggttgcacgttattgggaagccgccttcagcagaggaagcgatcgcaactttggtt
aatattgctgggttggatcgggctgaagaagagatccaaagtttacctcggattattgcc
aatagcgtcgggcgggatattgacgaaatttatcacaatagcgatcgcggtgtcttggaa
gacgtgcaattattacaagacatcacccttgcctcccgcgccgccgttagcgctttggta
caggcacaaaccgacgcagaaggaagagtttccctagtttctaagctcaatttcttcaac
atgggtaaaaaggaaccttgggtagaagctttgcatcaagcaggttacgccaaagtcgat
ccgaatgccctcaaacccctgtttgaatacttagaattctgcctgcaacaagtttgtgcg
gataacgaactgggggctttgttacggggattggaaggcgaatacattttacctggtcct
ggtggcgacccgatccgcaaccccgatgtgttgcctacaggtaagaatattcatgccctc
gacccgcaagcaattccaacaatggcagcggtgcgatcggcgaaaatcgtcgtagaccgc
ttgttagaccgcaataaggcagaaaatggtggaaaattccctgaaaccattgcctgcgtc
ctctggggaaccgataatatcaaaacttacggcgaatccctagcgcaaattatgtggatg
gtcggcgtgcgtccggttcccgatgctttaggacgggtgaacaagttggaattgattcct
ttagaagagttgggacgacccagaatcgatgttgtcatcaattgttccggtgttttccgc
gatttgttcatcaaccaaatgaacctgctagatcaagcggtgaaaatggcggcggaagcg
gacgaacctgtagaaatgaattttgttcgcaaacacgccttaaagcaagctgaggatatg
gggattaacttgcgccaagctgcaacccgcgtattttctaatgcttccggttcctactcg
tccaatattaatttggcagtggagaacagcacttgggacagtgaagctgagttacaggaa
atgtatctcaagcgcaaatcctttgctttcagtgccgataatccagggacgatggaacag
tcgcggcagatttttgaaactaccctgaaaactgctgaagtgacattccaaaatctcgat
tcttccgagattagtttaacggatgtctcccactactacgactcagatccgacaaaagtt
gtggcaagtctgcggaatgatggtaagatgcctacttcctacatggcagatacaactaca
gctaacgctcaagtccgtactttatcagaaaccgtgcgtttagattcccgtaccaagttg
ttaaatcccaagtggtatgaaggaatgttgtctcatggttacgaaggcgtgcgggaactt
tccaagcggttagttaatacaatgggttggagtgcgactgcgggtgctgtcgataattgg
atctacgaagatgctaacgacacgttcattaaagatgaagccatgcgtcagcggttgtta
aatttaaatcctcattccttccgcaagatggtttctactttattagaagcaaatgggcgc
ggttattgggatactgatgagaacaatttggatctgctacgcgagttgtatcaggaggta
gaagaccggatcgaagggattgaatag

DBGET integrated database retrieval system