KEGG   Chroococcidiopsis thermalis: Chro_1706Help
Entry
Chro_1706         CDS       T02360                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Chro_1706
Enzymes [BR:cthe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Chro_1706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1897222..1898424
Genome map
AA seq 400 aa AA seqDB search
MTHNSENPLFQSPDNNNHQPPTEAQRALELETRLPMTGWQQEVSKGIEYGLEAAQSIRDR
TIPTFSRGELPHYAGINTFLKAPYLEDVRQVGNYDVAIVGVPHDSGTTYRPGTRFGPQGI
RRISALYTPYNFELGIDLREQITICDVGDIFTIPANNEKSFDQISKGVAHVFSSGAFPII
LGGDHSIGFPTVRGVCRHLGDKKVGIIHFDRHVDTQETDLDERMHTCPWFHATNMKNAPA
KNLVQLGIGGWQVPRNGVKVCRDRATNILTVTDIVEMGLDAAAEFAIQRATDGTDCVYIS
FDIDCIDAGFVPGTGWPEPGGLLPREALSLLGKIVQKVPVCGLEVVEVSPPYDISDITSL
MATRVICDTMAHLVLSGQLPRKEKPAYIHPESQPELVAWT
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgactcataattctgaaaatcctttgtttcagagtccagacaataacaatcatcaaccc
cctactgaagcccaacgcgctttagaattagaaacacgactgccgatgacaggatggcag
caagaggtatcgaaagggatagaatacggattagaagcagcacagagtatccgcgatcgc
acgattcctaccttttctcgtggtgagttaccccactacgccggaattaatactttcctc
aaagccccatacttagaagatgtgcgtcaggtaggaaattacgatgtggcgatcgttggc
gttccccatgactccggtacgacctatcgccctggaaccagatttggacctcaaggtatt
cgccgcatttctgctttgtacacgccttataactttgagttgggtatcgatttacgcgaa
caaattacaatttgcgatgtgggagatatcttcaccattcccgccaacaacgaaaaatcc
ttcgatcaaatttctaaaggcgttgcccatgttttcagttcgggggcatttccaattatt
ctgggtggcgatcactcgattggtttccccacggtaaggggtgtatgtcgccatttagga
gataaaaaagttggtatcattcacttcgatcgccacgtagacacccaagaaaccgattta
gacgaacggatgcatacttgcccgtggtttcacgccactaatatgaaaaatgcgccagct
aagaatttagtccaactgggcattggtggttggcaagtcccaagaaacggggtgaaagtc
tgtcgcgatcgtgctaccaatattctcacagttacagatatcgtcgaaatgggcttagac
gcagccgcagaatttgcgattcaaagagcaacagacggtacagactgcgtttacatcagt
tttgatatcgattgtatagatgcaggatttgttcctggtactggctggcccgaaccgggc
ggtttgttaccccgcgaagccctgtcactactgggtaaaatcgtgcaaaaagtccccgtt
tgcggtctagaagttgtggaagtatcgcccccttacgacatcagcgatatcacctctcta
atggcaacccgcgtaatttgcgatacaatggcgcatcttgtcctatcgggacaactaccc
cgcaaagagaaaccagcttacattcatcccgaatcccaacccgaacttgtggcttggact
tag

DBGET integrated database retrieval system