KEGG   Chroococcidiopsis thermalis: Chro_2041Help
Entry
Chro_2041         CDS       T02360                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Chro_2041
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Chro_2041
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Chro_2041
Enzymes [BR:cthe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Chro_2041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2287518..2288612)
Genome map
AA seq 364 aa AA seqDB search
MTLSLSANTSSNCQNWSGLIETYRHYLPVTDQTPVITLLEGNTPLIPAPAIAAQIGRQVR
VLVKYDGLNPTGSFKDRGMTMAISKAKEAGAKAVICASTGNTSASAAAYARRGGMRAFVL
IPDGYVALGKLAQALLYGAEILAIKGNFDRALEIVRQMAETYPVNLVNSVNPYRLEGQKT
AAFEIVDNLGNAPDWLCIPVGNAGNITAYWMGFCQYHSLGKCDRLPKMMGFQAIGAAPLV
TGQAVTHPETIATAIRIGNPASWQKAIAVQTASAGEFNAVSDAEILDAYRFLAAEEGIFC
EPASAASVAGLFKVKDRVPSGATVVCVLTGNGLKDPDTAINHSQNTFKQGIEPTLDSVAK
VMGF
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgactctaagcctgtctgctaatacatcatcaaattgccaaaattggtctggactgata
gaaacatatcggcactatttgcctgttaccgaccaaactccagttataactttattagag
gggaacacacccctaattcccgcccctgcgatcgcggctcaaattggcagacaggtgcgc
gtactcgttaagtatgatggattgaaccccacgggtagcttcaaagaccgaggcatgacg
atggcaatctccaaggcaaaagaagccggagccaaagctgtcatttgtgccagtacgggc
aatacctcagcatcagcagcagcttacgcgcgacgcggcggaatgcgagctttcgtctta
attcccgatggctacgtcgctctaggaaaactagcacaagctttgctgtatggagcagaa
atactagcaatcaaaggcaacttcgatcgcgccctagaaattgtgcgccagatggcagag
acttatccagtgaatttggtgaattcggtcaatccctatcgtttagaagggcagaaaacc
gcagcatttgagattgttgacaatttaggcaacgcccccgactggttgtgcattcccgta
ggcaatgcaggaaacatcactgcatattggatgggattttgtcaatatcatagtctaggg
aagtgcgatcgcttacctaaaatgatgggatttcaagcaattggcgctgctcctttagtc
acgggacaagccgtaactcaccctgagacaattgctacagctatccgcattggcaacccc
gccagctggcaaaaagcgatcgcggtacaaacagctagtgcgggagaattcaatgctgtc
agcgatgccgaaattttggacgcataccgttttctcgctgccgaagaaggcattttctgc
gaacctgccagcgctgcttctgtggctggattattcaaggtgaaagatcgagttcctagt
ggtgcaaccgttgtttgcgttttaaccggaaacggcttgaaagacccagacacagccatc
aaccacagccaaaatacgtttaagcaaggcattgagccgacattggactcggtagcaaaa
gtcatgggattttaa

DBGET integrated database retrieval system