KEGG   Chroococcidiopsis thermalis: Chro_2109Help
Entry
Chro_2109         CDS       T02360                                 

Definition
DNA-(apurinic or apyrimidinic site) lyase, Formamidopyrimidine-DNA glycosylase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:cthe03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2359944..2360873
Genome map
AA seq 309 aa AA seqDB search
MPELPEVETVRRGANQVTLNREITGGDVLLDRTIAYPFSVADFLNGISGKAIAQWHRRGK
YLLAELVKGSREQGAIPSCKSQVASRKSQLIPNSEFRIPNSEFLGVHLRMTGQLLWLPQD
EPLHKHTRVRLFLAENWELRFVDQRTFGQMWWVPPERVVESVVTGLATLGPDPFSSDFSV
EYFATKLRDRRRPIKNALLDQSIVAGIGNIYADEALFRAGVQPQTLCADLRSPQISRLRT
AILEVLEASINAGGTTFSNFLNVQGVNGNYGGVAWVYNRAGKPCRICNTPILKLRLAGRS
AHFCPQCQK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgaattgccagaggtagaaacagttcgacggggtgcaaatcaagtcaccctgaat
cgagaaattacgggtggggatgtgttgctcgatcgcaccatcgcctacccgttttctgtg
gcagattttctcaacgggatctcgggaaaagcgatcgcccaatggcatcgacgcgggaag
tatctgctggcagagttagtcaaagggagcagggagcagggagcaattccaagttgcaag
tcgcaagtcgcaagtcgcaagtcacaactaatcccaaattccgaattccgaattccgaat
tccgaatttcttggtgttcacttacgaatgactggacagctgttatggcttccacaggac
gagcctttacacaaacatacgcgagtccgattatttttggctgagaattgggaattgcgc
ttcgtcgatcaacgcactttcggacagatgtggtgggttcctccagaacgagtggttgaa
tcagtcgtgacgggattagcaacattgggtcccgatccgttttcttcagatttttctgtg
gaatattttgcgacaaaattgcgcgatcgccgtcgtccgatcaaaaatgccttattagac
caatcaatcgttgcaggaatcggtaacatctacgctgatgaagcgctgtttcgcgctggc
gtgcaaccccagaccttatgtgcggatttgcgatcgccacaaatatcgcgcctgcgaacc
gccattcttgaagtgttagaagcgagtatcaacgctggtggcacgacttttagtaatttt
ctcaacgttcaaggcgttaacggtaattatggcggtgtagcttgggtttataaccgagca
ggcaaaccctgccgcatctgcaatactcccatactaaaactacgtttagctgggcgatcg
gctcacttctgtccgcaatgccagaaatga

DBGET integrated database retrieval system