KEGG   Chroococcidiopsis thermalis: Chro_2132Help
Entry
Chro_2132         CDS       T02360                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cthe  Chroococcidiopsis thermalis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2385849..2387003
Genome map
AA seq 384 aa AA seqDB search
MAKKTLFTRRQTLFFWLSTFASLSLLTSKNAFNPRQIDPLSRKFVASGNMSIGKRALIKG
LSYGAAVNKNSLSSNPQLAASIDKECVIIVPEWELKWDFLRPTSTSFDFRPADWLAEFAR
THGLLFRGHTLVWHEALPTWFVKTINSHNARQLLLEHITTVVKHYAGNIHSWDVVNEAIN
LQDGRSDGLRKTPWLQFIGRDYIEIAFCIAAEADPKAMLVYNDYGLEYDTPEHEAKRKAV
LNLLKNLKSKGTPIHALGIQSHLSGDETRFNSDKFQKFLSEIASLDLKILITEIDVKDKN
LPVDIKVRDRIVAATYEDYLSVVLNEPAVIAVLTWGLSDRYTWLSEYQPRRDGARVRPLP
LDANFKRKLAWNAIARAFDNAPQR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaaactttattcacaagaagacaaacattgttcttctggttaagtacgttt
gctagcttgagtcttttaactagtaagaatgcattcaacccaaggcaaatcgatcctcta
agtagaaagtttgtagcaagtgggaatatgtctataggtaagcgagcgctgattaaggga
ttatcttatggagcagcagttaacaaaaattccttatcttcaaatccacagttagcagca
agtattgataaagagtgcgtaatcattgttccagaatgggaattaaagtgggattttcta
cgccccacatctacttcttttgactttagacctgctgattggttggctgagtttgcccgc
actcacggattgctatttcgcgggcatactttagtttggcatgaggctttgcccacatgg
tttgtcaaaactatcaatagccacaatgctagacagctattactagaacacattactaca
gttgttaaacattatgctgggaatatccattcatgggatgtggtaaatgaagccattaat
ttacaggatggacgctctgacgggttgagaaaaacaccttggctgcaatttataggacga
gactatatcgaaatagcattttgtatagcggcagaagcagatcctaaagcaatgctagtt
tataatgattatggacttgaatatgatactcccgagcatgaggctaaaagaaaggctgta
ttgaatctattaaagaatttaaagtctaagggtacacctattcatgctttgggtattcaa
tctcacttgtcaggtgacgaaactcgctttaattctgataaatttcagaaatttctcagt
gaaatagctagtctggatctcaaaatcttaattacagaaatagatgtcaaagataaaaac
ttacctgtagatatcaaagttcgcgatcgcattgtcgccgctacttatgaagattatctt
tcggtagtactaaatgagccagcagtcattgcagttttaacgtggggattgagcgatcgc
tatacctggctctcagaatatcaacctcggcgagatggtgcaagggtgcgacctttaccc
ttagatgccaattttaaacggaaactggcatggaatgcgatcgcccgtgcttttgataat
gctccccaacgttaa

DBGET integrated database retrieval system