KEGG   Chroococcidiopsis thermalis: Chro_2177Help
Entry
Chro_2177         CDS       T02360                                 

Definition
Cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
cthe  Chroococcidiopsis thermalis
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2439860..2441428)
Genome map
AA seq 522 aa AA seqDB search
MKNRFRSRRRFLQTTALISASAALSPLASIYRASAQDRNVPDEAVEALVLGSGFGGAITA
LRLTQAGIRTLMIERGIRWPIRDDGNTFATFQQIDGRAAWLSNTTWNGVPVDPFTGVLDF
SQENGINILHGAGFGGGSLVYNAITYQPRREIFSGIFSPDVVDYDELDAVYYPRVRSLLQ
PASIPDDILASPYYDRARLLIEQGNRAGFATYPYNLAVDWNIIRQEIEGTKIPSAILGNH
WYGINSGAKNSLDRNYLFQAEQTGLLDVLTLHLATDITEVPEYGYRVLCTQIDTSGAVVA
QKSFTCRYLFLAAGSIGTSKLLVRSKATGLLPKLNDEVGKHWGGNGDAIVTRSNLLPSVS
GKGGPACVVLEHLDNPLGATVFEDIPDANAADGTLQLLALGIPRQTGTFTYNASTDSVRL
NWTQDNAQLDAVKLTAQILDEKNTTSTSQPTSAFINSISGHPLGGATLGKACDRYGRVAG
YKRLYVMDGAMIPGYTAITNPSFTIAALAERNIEKIIAEDLG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaagaataggtttcgcagccgtcgtcgctttctgcaaactactgcacttatttctgct
agtgctgccctaagtccgctagctagtatttatcgcgcgagcgcccaagatcgaaatgtt
ccagatgaagctgtagaagctctagtccttggtagcggttttggcggagcgattacggct
ctgcgcttgacacaagctgggattagaacattgatgatagagcgaggaatccgctggcct
atcagagatgatggaaatacttttgctacttttcaacaaatagatggtcgagctgcctgg
ttaagtaatacgacatggaatggagttcccgtcgatccgtttacaggagtgctagacttt
tctcaggaaaatggaattaatatcttgcatggggctggctttggaggtggatcgttagtt
tataacgcgattacttaccaacccaggcgcgaaatcttcagcggtattttttctcctgat
gttgtggactatgatgaattggatgcagtttattatccgcgcgtgcgatcgctcctacaa
cccgcaagcattcctgatgatattttggcaagtccttactacgatcgcgctaggttatta
atcgaacaaggaaatagagcaggctttgctacatatccatataatcttgcagtagattgg
aatataattcgccaagaaatagaaggaacaaagataccttctgcaattctaggtaatcac
tggtacggcattaacagtggggctaaaaatagcctggatcgtaactacctatttcaggca
gagcaaactggattattagatgttttaacattacatctagctacagatattactgaagta
cctgaatatggatacagagttttatgtactcaaattgacacatcaggagcagtcgtcgct
cagaagtctttcacctgtcgctatttatttttagcagctggttctattggaacttccaag
cttttagttagatctaaagcaacgggcttattaccaaaattaaacgatgaagttggcaaa
cattggggaggtaatggagatgcgattgtaactcgtagcaacttattgccgtctgtatct
ggtaagggaggaccagcatgtgtagttttggaacacctagataaccctcttggtgcaact
gtttttgaggatattccagatgcaaatgcagctgatggtacgctacagttactcgcttta
ggtatacctcgacaaacagggacatttacatataacgcatctactgattctgtccgcttg
aactggactcaagacaatgctcaattagatgctgtcaagttaactgctcaaatccttgac
gagaaaaatacgacctctaccagtcagcctacatcagcatttatcaattccatctctggg
catcctctaggaggagcaacactaggaaaagcctgcgatcgctacgggcgcgtcgctggg
tataaacgtctttatgtcatggatggagccatgattcctggctatacagctatcacaaat
ccttcctttactattgcggctttagcagaacgcaatatagaaaaaatcattgctgaagat
cttggatag

DBGET integrated database retrieval system