KEGG   Chroococcidiopsis thermalis: Chro_2779Help
Entry
Chro_2779         CDS       T02360                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Chro_2779
DNA repair and recombination proteins [BR:cthe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Chro_2779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3091333..3091911
Genome map
AA seq 192 aa AA seqDB search
MARLIEQLQRLPGVGPKTAQRLALHILKRPEAEVEALAQALLEAKKQVGLCKVCFHLSAE
PVCEICRNSNRDNNTICVVADSRDVIALEKTREYHGKYHVLGGVISPMDGIGPEQLTVQS
LVQRVSQQQPKEVILAIGPSVEGETTTLYVGQLLKPFTKVTRIAFGLPVGGDLEYADEVT
LARALEGRRELD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
ttggctcgtttgatcgagcagttgcagcgcttgccaggagtcggtcccaagaccgctcag
cgccttgctctacatattttgaagcgtccagaagcagaagttgaagccttagcacaggct
ttgttagaagcaaaaaaacaagtgggtttgtgtaaagtttgctttcatctctcagccgaa
cccgtttgcgagatctgccgtaactctaaccgcgacaataatacaatttgtgttgtggct
gactcccgcgacgtgattgctttggaaaaaactagagaatatcacggcaaatatcacgtt
ttggggggagtcatttcaccgatggatggcatcggacccgaacagctaacagttcaatca
ctggtacaacgggtgagtcaacaacaacccaaggaagtgattttagcaattggtcctagc
gtggaaggagagacgacaacgctgtatgtcggtcaactcctcaaaccattcacaaaagtg
acgcgaatcgcctttggtttacccgtaggtggcgatttagaatacgctgacgaggtgacg
ttagcaagagctttagaagggcggcgggaactagattag

DBGET integrated database retrieval system