KEGG   Chroococcidiopsis thermalis: Chro_2879Help
Entry
Chro_2879         CDS       T02360                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
cthe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cthe01100  Metabolic pathways
cthe01110  Biosynthesis of secondary metabolites
cthe01130  Biosynthesis of antibiotics
cthe01230  Biosynthesis of amino acids
Module
cthe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Chro_2879
Enzymes [BR:cthe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Chro_2879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ThiG NanE FMN_dh IMPDH
Motif
Other DBs
NCBI-ProteinID: AFY88348
UniProt: K9U157
Position
complement(3195902..3196783)
Genome map
AA seq 293 aa AA seqDB search
MQIRRRPPNPSIEISYLSYQVSVPGAKPQHILEEIVWHKEIEVDRLREKLPLVELQKQAL
TAPPTRDFIAALRQGKTSPAVIAEVKKASPSKGVLREDFDPVAIALSYQQGNASCISVLT
DSKFFQGSFDYLEQIRAAVDVPLLCKDFIIYPYQMYLARLRGADAVLLIAAILSDRDLQY
FIKIAKALKLAALIEVHTLEELDRVLALDGVTLIGINNRNLENFSVDLQTTSQLLTARQP
QLKQRDILVVSESGIHAPADVAVVTQAGAAAVLVGESLVKQPEPGNAIASLLG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatccgtcgtcgtccgccaaatccgtctattgagattagttatttgagctatcag
gtatcagttccaggtgcaaagccgcagcatattttagaagaaattgtgtggcacaaagag
attgaagtcgatcgcttgcgggaaaaactaccgctagtagagttacaaaagcaagcctta
actgcacccccaactcgcgattttatagctgctttacgtcaaggtaagacttctccagca
gtaattgctgaggtgaaaaaagcttctcctagtaaaggcgtattgcgagaagatttcgat
ccagtcgcgatcgcgctttcctatcagcaaggtaatgctagctgtatttcggtactgaca
gatagtaaattctttcaaggcagtttcgattatttagaacagattcgcgctgcggtagat
gtacctttgttgtgtaaggattttattatctatccttaccagatgtatctagcacggtta
cggggtgctgatgcggtgttgttgattgctgcaattttgagcgatcgcgatttacaatat
ttcatcaaaattgctaaagctttgaagttagccgctttaatcgaagtccatactctagaa
gaactcgatcgcgttttggctttggatggcgtaactttgataggtatcaataatcgcaat
ctggaaaacttttctgtcgatttgcaaacaactagccaactattaaccgcacgtcagcca
caattaaaacaacgagatattttagttgtcagcgagtcgggaattcacgcgccagccgat
gtagctgtagtcactcaagcaggtgcagcagcagtgctagttggcgagtctttagtcaag
cagccagaaccagggaatgcgatcgcttccctgttaggatga

DBGET integrated database retrieval system