KEGG   Chroococcidiopsis thermalis: Chro_3290Help
Entry
Chro_3290         CDS       T02360                                 

Definition
Cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
cthe  Chroococcidiopsis thermalis
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Chro_3290
Enzymes [BR:cthe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Chro_3290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3676685..3678190)
Genome map
AA seq 501 aa AA seqDB search
MVHKLHKNDESVEALVIGSGFGGAVAALRLGQAGINTVVLERGRRWQITPAQNTFATPHN
PDGRAAWLSPATIFGQPIDVHTGVMETLVEDGIIVLNGAGVGGGSLVYNSIIYQPIPELF
QKVFPGSISYDEMDTVYYPRVHSILQPSPIPPDILNTIYYDTTRLFIQHATQAGFRNHLL
ELAVDWNIVREEINGTKVQSTIVGDHWWGINSGAKKSLDRNYLSQAEKTGFVEILPLHVA
VEIAETPEAGYRVSCHQINESGEVVEQKSFRCRYLFLAAGSMGTSKLLVKAKATGSLPRL
NDYVGKFWSSNGDTIATRSNLPPVSGKGGPAGAVLENFDDLDRPIVLINLENWASPEGTQ
QCLGLGLPSQSGTFTYDASTDSVKLHYPRETQLMVDTEKTYKTLDSKNAISTKTPMTEMK
FYTPTTTNRPAPETDVVITAHPLGGAVLGKACDDYGQVSGYRGLYVVDGALIPGSTGCTN
PAYTIAALAERCMDRIIADIH
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggttcataaactacataaaaatgatgagtctgtagaagctcttgttatcggtagtggt
tttggtggagccgttgcagctttacgcttgggacaagcaggcatcaatacagtagtgcta
gagcgaggtcgtcgttggcaaattacgcctgcccaaaatacttttgctactccccataat
cctgatggtcgagccgcttggcttagtccagcaactatattcggacagccaatcgacgta
cacacaggtgtgatggaaaccttagttgaagatggaattattgttttaaatggtgctgga
gttggcggcgggtcattagtttacaacagtattatttatcaacccattcctgagttattc
cagaaggtttttcctggttcgattagttatgatgaaatggatacagtttattaccctcgc
gtccattcaattttacagccttcgccaattcctccagatattttaaatactatttactat
gatacgacgcggctatttattcaacatgctactcaagcaggattccgcaatcatctacta
gaattagccgttgattggaatatagtccgggaagaaattaacggaacaaaagtacagtct
actattgtcggagaccattggtggggtatcaatagcggcgctaaaaaaagcttggatcgc
aattacttatcccaagcagaaaaaactggtttcgtagaaatacttcctctacatgtagca
gtagagattgctgaaacccctgaagctggttaccgggtttcatgtcatcaaataaatgaa
tcaggagaggttgtcgaacaaaaatcttttcgctgtcgctatttgtttttagcagctggg
tctatgggaacttctaaacttttggtcaaagctaaagcaacaggctcattacctagacta
aatgactacgttggtaaattttggagttctaatggcgataccattgctactcgttcaaat
ttaccacctgtatctggtaaaggaggacccgcaggtgcagtgttagaaaacttcgatgac
ctcgatcgcccgatagtactgataaatcttgaaaattgggctagtcctgaaggaacgcaa
cagtgtcttggtttaggtctaccctcacaaagtggaaccttcacgtatgatgcgtctaca
gattctgtcaagttacactatccccgagaaactcaactcatggtagatacagaaaaaacc
tacaaaactcttgacagtaaaaatgccatttctaccaaaacacccatgacggaaatgaaa
ttttatactcccacaaccacaaaccgacccgctcctgaaactgatgtcgttatcactgcc
catccactggggggagcagttctaggaaaagcgtgcgatgactacgggcaagtatctggt
tatcgaggactttatgtcgtcgatggtgcgctgattcctggctctacaggatgtacaaat
cctgcatacacgatcgccgctttagcagaacgctgtatggatcgaatcatcgcagatatt
cactaa

DBGET integrated database retrieval system