KEGG   Chroococcidiopsis thermalis: Chro_3457Help
Entry
Chro_3457         CDS       T02360                                 

Definition
MCP methyltransferase, CheR-type with PAS/PAC sensor (EC:2.1.1.80)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Chro_3457
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Chro_3457
Enzymes [BR:cthe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Chro_3457
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Chro_3457
Two-component system [BR:cthe02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Chro_3457
Bacterial motility proteins [BR:cthe02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Chro_3457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3855653..3857530
Genome map
AA seq 625 aa AA seqDB search
MTDEANAEFEALINYIKRNRGFDFTGYKRSSLMRRVRKRMQALDLENFSDYMDRLEVAPE
EFVLLFNTILINVTSFFRDRATWDYVTTEIVPRITARKEPTEPIRIWSAGCASGQEAYTL
AMVMAEAVGVEQLRQRVKIYATDVDEEALNQARHATFNEREVSSVPPEMLELYFENSNGV
YTFRKDLRRSVIFGRHDLLQDAPISRIDLLLCRNTLMYFNAEAQSRIIARFHFALNDAGF
LFLGKAEMLLSHGDSFTPVDLKRRIFIKVPKGNTRDRLLLMGNNHVDDEANYLASHVRIR
DTAFDLNPTAQIAIDVNGLLTLANERARNLFNIHPRDLGRPLQDLEISYRPLELRSRIEQ
AYAERRAVNQTEVEWISASGETLYFDVQISLLQDINGRMLGCSIVFIDVSRSRRLQEELE
HSNQELEMAYEELQSTNEELETTNEELQSSNEELETTNEELQSTNEELETMNEELQSSNE
ELQTINEELRLRSEELNQVNAFLESILTSLRGGVVVVNRELQVQVWNNKAEDLWGLRSNE
VEGQHFLNLDIGLPVGQMRQQIRSCLAGESRSIEVFLDAINRRGKAIQCKVTLTPLMDYR
QGIHGVIMLMEEQGSVTSDSSITDN
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgaggctaatgctgagtttgaagcattaattaactacattaaacgcaatcgc
ggatttgattttacaggttacaagcgttctagtttgatgcggcgagtgcgcaaacgaatg
caggcactcgaccttgagaacttcagcgattacatggatcgcctagaggtagcgccagag
gaattcgtccttttgttcaacacaattttgatcaatgtcacgtccttttttcgcgatcgc
gctacctgggactacgtgacgacagaaattgtgcctcgaattactgcccgcaaggaacct
acagaaccaattcggatttggagtgctggctgtgcttcgggacaagaggcttacacttta
gcaatggtgatggctgaagcagtgggagtcgagcagttgcgtcagcgcgtcaaaatttat
gcgacagatgtggatgaagaagcgctcaaccaagcccgccacgctactttcaacgaacga
gaggtgagttccgttccgccggaaatgttagaactttattttgagaattccaatggtgtt
tatacttttcgtaaagacctccgccgttcggtgattttcggtcgtcatgacttgttacaa
gatgcacctatttcccgcattgacttgttgttatgccgcaacacgttgatgtatttcaat
gctgaagctcaatcgagaattattgcccgctttcactttgctttaaatgatgctggcttc
ttatttttaggtaaagcggaaatgttgctcagtcatggtgattctttcacgccagtcgat
ttgaagcgccgaatttttattaaagttcctaaaggaaatacgcgcgatcgcttgttgctt
atgggtaacaatcacgtcgatgacgaagccaattatttagctagccacgtccgcattcgg
gacacggcatttgacctcaatcccaccgcacagatagcgatcgatgtcaatggactactc
acattagctaacgaacgcgcccgcaacttatttaacattcaccctagagatttgggtcgt
cccctgcaagacctggaaatttcttatcgccctctagaactgcgctctcggatcgagcaa
gcctatgccgaacggcgtgctgtcaaccaaacagaggtagagtggatttctgcctctgga
gagactttgtattttgacgtacaaatatcgctcctgcaagatattaacgggagaatgctg
ggatgcagcattgtttttatcgatgtcagtcgctctcggcggttgcaagaggaactagaa
cattccaatcaagaattggaaatggcttatgaagaattacagtcaaccaatgaagaatta
gagacaaccaacgaagaattgcaatcttctaatgaagaactggagacaacgaacgaggaa
ctgcaatcgactaatgaagaattggaaaccatgaatgaagaactgcaatcttccaacgaa
gaattgcagacaattaatgaagaactgcgattgcgcagcgaggaactgaatcaagtcaac
gcctttctagagtcgatcctcaccagtcttcgcggtggagtggtagtcgtgaatcgcgaa
ctgcaagtccaagtttggaataataaagctgaagatctatggggcttgcgcagtaacgaa
gttgaaggacaacattttttaaacttggatatcggtctaccagtcgggcagatgcgacag
caaattcgctcttgcctagcgggagaatctcgctctattgaagtgtttctagatgcaatc
aatcggcgcggtaaggcgatccaatgtaaagtcactctcacccctttaatggattatcgg
caaggaattcacggggtcatcatgttgatggaagaacaagggtcagtgaccagtgactcc
tcgataactgataactga

DBGET integrated database retrieval system