KEGG   Chroococcidiopsis thermalis: Chro_3464Help
Entry
Chro_3464         CDS       T02360                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
cthe00240  Pyrimidine metabolism
cthe00250  Alanine, aspartate and glutamate metabolism
cthe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Chro_3464
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Chro_3464
Enzymes [BR:cthe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Chro_3464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace DUF4431
Motif
Other DBs
NCBI-ProteinID: AFY88922
UniProt: K9U1F6
Position
3869420..3870475
Genome map
AA seq 351 aa AA seqDB search
MIWNRHHILSLEDFTPEEYNTVLQTAASFREVLTRRTKKVPTLQGQVVTNLFFESSTRTR
SSFELAAKRLSADTLNFTASTSSLTKGETILDTAKTYLAMGTDMMVIRHREAGVPQAIAS
EMDRLNVRVGVLNAGDGQHEHPSQALLDLFTICTLLDPDRPRLELLQGKKIAIVGDILHS
RVARSNIWSLTASGAEVHLAAPPTLLPQMFGEFVDTRSEERGARSEGDRGNHNQPSTVNC
QPNRKLFLHWQIEPALQDADFVMTLRLQRERMAQHLLPSIREYHQLFGITRDRLQLCKPD
VKVLHPGPVNRGVEISSDLMDDPQFSLISQQVTSGVAVRMALLYLMGGGKV
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgatctggaatcgccatcacattttgtctctagaagattttacgccggaagaatacaac
acggtgttgcagaccgctgcaagttttcgagaggtgttgacgcggcggacgaagaaagtc
ccaaccttacaaggacaggtggtaacgaatttattttttgaatcttcgactcgtacccgc
agcagttttgaattagcagccaaacgtttatcggcagatacgctaaactttaccgcctct
acctcttctttgacgaagggggaaacaatattagacacggcaaaaacctacttggcaatg
ggaaccgatatgatggtgatccgccatcgagaagcgggagttcctcaagcgatcgcatct
gaaatggatcgcttgaatgtccgcgtcggagtcttgaatgctggggacggacagcacgaa
catccttctcaagctttactcgatctatttacaatttgcactctgctcgatcccgatcgt
ccgcgcttggaactgttacaggggaaaaaaattgcgatcgtcggggatatccttcattca
cgggtagcgcgatcgaatatctggagcttaaccgctagcggggcagaagtccaccttgct
gcaccaccgacattgttaccgcagatgtttggggagttcgttgatacgaggagtgaggag
cgaggagcgaggagtgagggagatcggggaaaccataatcaaccgtcaactgtaaactgt
cagccaaatcgcaaattatttttacattggcaaatcgaacccgcattacaagatgcagat
tttgtgatgacgctgcggttgcaaagggaacgcatggcgcagcacctcttacccagtatt
agagagtaccatcagttatttggaattacgcgcgatcgcctacaactttgtaaacctgat
gttaaagttttacacccaggtcctgtcaatcgtggcgtagaaattagttccgatctgatg
gacgatccccagttcagtctaatttcccagcaggtgacgagtggggtagcggtgcggatg
gcgctgttatatctcatgggtggtggtaaggtttag

DBGET integrated database retrieval system