KEGG   Chroococcidiopsis thermalis: Chro_3472Help
Entry
Chro_3472         CDS       T02360                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cthe00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3879170..3880111
Genome map
AA seq 313 aa AA seqDB search
MRSYSLIAPAKINLYLEILGDRPDGYHELVMILQSIDLADKIDLRAISTDTIRVHCDNAQ
VPADKSNLAYRAAELMAKQFPESFAQYGGVEITIHKKIPIAAGLAGGSSNAAAVLVGIDL
LWKLGLTQSELQELAAQIGSDVPFCIAGGTAIATGRGEQLSPLPSLDNLYIVLGKHRSLA
VSTVWAYSTYRATFGHTYTRNIQNLESRAQAVHSGSMVKAIIHEDGAEIAQKLHNDLEKV
VLPEYPKVSQLRQAFQASGANGAMMSGSGPTVFALCTSLEQAQQVHQQVRQIIPDPDLDL
WIARMCSGGIQVS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcctattctctgattgctccggcaaaaataaatttgtatctggaaatcttaggc
gatcgcccagacggatatcacgaattggtcatgatcctacaaagtatcgatctggctgac
aaaatcgatctgcgggcaattagtaccgatacaatccgcgttcactgcgataatgcccaa
gttccagcagataagagcaatctcgcttatcgcgccgccgaactgatggcgaaacaattt
ccagaaagttttgctcaatatggcggggtagaaattacgattcacaaaaagatcccaatt
gctgctggattagcaggaggatctagcaatgctgctgccgttttggtcggcatagattta
ttgtggaaactgggactcacgcaatcggaattgcaggaactcgcagcccaaattggttct
gacgtacctttttgtattgcaggcggaacagcgatcgccacaggacggggagaacagctt
tctcctctccccagtctcgataatttatacatcgttctcggtaaacaccgtagtttggca
gtctctacagtttgggcgtattcaacctatcgcgccaccttcggtcatacctacacgaga
aatattcaaaacttagaatctcgcgctcaagccgtccactcaggttcgatggtgaaagcg
attattcatgaagatggggcagaaattgcccaaaaactgcacaacgatttagaaaaagtc
gtgttaccagaatacccaaaagtttcgcaactgcgacaagcatttcaagccagcggcgct
aatggtgcgatgatgtctggttctggtcccacagtatttgctttatgtacttctttagaa
caagctcagcaggtacaccagcaagtccgccaaatcatccccgatcccgatctagactta
tggattgctcgaatgtgtagtgggggaattcaagtcagttaa

DBGET integrated database retrieval system