KEGG   Chroococcidiopsis thermalis: Chro_3790Help
Entry
Chro_3790         CDS       T02360                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Chro_3790
Enzymes [BR:cthe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Chro_3790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4293784..4294422
Genome map
AA seq 212 aa AA seqDB search
MTFSISPDEILKQSAIATAKSPVSEAEMMQAVRTLLLGMGEDPDREGLRDTPKRVVKALK
FLTSGYRQSLDELLNGAIFHEDADEMVLVRDIDLFSSCEHHILPIIGRAHVAYIPNGKVI
GLSKIARICEMYARRLQVQERLTVQIADALQGLLKPQGVAVVVEATHMCMVMRGVQKPGS
WTVSSAMRGVFADDAKTRQEFMSLVRHSPAFH
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgacattttcgatttcaccagacgagattctgaaacaatctgcgatcgccacagcaaag
tcacccgtttctgaagcagagatgatgcaagccgttcgcacgttgctgttaggcatgggt
gaagatcccgatcgcgaaggtttgcgcgatacgcctaaacgagttgtaaaagcactcaaa
tttctcacatctggctatcgtcaatccctagacgaactgctcaacggagctatcttccac
gaagatgcggatgaaatggttctggtacgggatatcgatttgtttagctcttgcgaacat
catattttaccaattattggtagagcgcatgttgcctatattcccaacggtaaagtcatt
ggcttatccaaaattgcccgcatttgtgaaatgtacgctcgtcgcttgcaagtgcaggaa
cgcctgacggttcagattgccgatgcgcttcagggtttattgaagccacaaggagttgcg
gtagtggtcgaagcaactcatatgtgcatggtgatgcgcggcgtgcagaaacctgggtct
tggacggttagtagtgccatgcgtggggtctttgcagacgatgccaaaactcgccaggag
tttatgagtttagtgcggcactctccagcattccattag

DBGET integrated database retrieval system