KEGG   Chroococcidiopsis thermalis: Chro_4110Help
Entry
Chro_4110         CDS       T02360                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cthe00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4647044..4647640)
Genome map
AA seq 198 aa AA seqDB search
MIQLYDFVLSGNCHKVRLLLSILNLDYESVPVNLKAGEHKTERFLQLNPCGQVPVFVDGD
VILRDSQAILVYLARRYGGEDWLPLELEAIAKIMQWLSFAANEIANSLAAARRYFIFKGQ
LDIDLTQQKAYQVLQILDRHLTNNQWLESSHPTIADLACFPYVGLAADAKVALDNYPHVI
AWCDRIKRLPGYVSMPGL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgattcagctatatgactttgtactatctggtaattgccataaagtcaggctgttgctg
tcgatattgaacttagattatgagtcagtacccgtcaacttaaaggcaggagaacacaaa
accgaacgatttctgcaactcaacccttgcggacaagtaccagtttttgtggatggtgat
gtaatattacgagattcccaggctattttagtgtacctagcccgacgctacggcggcgaa
gattggttacctctagagcttgaagcgatcgcaaaaattatgcagtggttgtcttttgcc
gcgaatgagattgccaatagtctggcggcggcgaggagatattttatctttaaagggcaa
ctcgatatagatttaactcaacagaaagcttatcaagtattgcaaattctcgatcgccat
ttaacgaataaccagtggttagaaagcagccatcctacaatagccgatcttgcctgcttc
ccctatgtcggactagccgcagacgcaaaagttgctttagataactatcctcacgttatc
gcttggtgcgatcgcatcaagcggttaccaggttacgtcagtatgccaggactgtaa

DBGET integrated database retrieval system