KEGG   Chroococcidiopsis thermalis: Chro_4139Help
Entry
Chro_4139         CDS       T02360                                 

Definition
(GenBank) Delta-9 acyl-phospholipid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
cthe01040  Biosynthesis of unsaturated fatty acids
cthe01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Chro_4139
Enzymes [BR:cthe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Chro_4139
Lipid biosynthesis proteins [BR:cthe01004]
 Desaturase
  First
   Chro_4139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: AFY89543
UniProt: K9U4I0
Position
complement(4675663..4676475)
Genome map
AA seq 270 aa AA seqDB search
MTIATPTKLTINWVNTLFFIGLHFGALFALLPSNFSWQAVGVAVFLYWVTGGLGVTLGFH
RLVTHRSFQTPKWLEYFLVFCGTLACQGGPIEWVGTHRAHHLYSDTEPDPHDSNKGFWWS
HIGWLIYRRPIELDLARFTKDIAGDPVYQFLEKNMIFIQIALGVVLLLLGGWSFVVWGIF
VRVVFVYHCTWLVNSATHKFGYRSHESGDRSTNCWWVALLVFGEGWHNNHHAFQYSARHG
LEWWEVDLTWMTICLLQALGLAKNVKLAEK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgctaccccaaccaaactgacaatcaactgggtcaataccctattttttatt
ggtttgcattttggagctttatttgctctactccctagcaacttcagctggcaagcagtt
ggtgttgccgtgtttctctactgggtcactggcggtttgggagttactctaggctttcac
cgtcttgtcacccaccgcagctttcaaactccaaaatggctggagtatttcttggtcttt
tgcggaacactcgcctgtcaaggaggaccgattgaatgggtagggacgcaccgcgcccat
catctttactccgataccgaacccgatccccacgactctaacaaaggtttttggtggagt
cacatcggctggttaatttatcgcagaccgattgaattagatcttgctcgttttacaaaa
gatattgctggcgatccagtttatcaatttctagaaaaaaatatgattttcatccagatc
gctctgggtgtcgtcctattattacttggtggctggtcgtttgtcgtctggggaattttt
gtgcgagtcgtgttcgtctaccactgcacctggttggtaaacagcgccacgcacaaattt
ggctatcgcagccatgaatccggcgatcgctcgaccaactgttggtgggtagccctgttg
gtgtttggcgaaggctggcacaacaaccaccacgccttccaatactctgcccgacacggc
ttagagtggtgggaagtcgatctcacctggatgacgatctgcttgctacaagctcttggc
ttggctaaaaatgtgaagctggctgaaaagtag

DBGET integrated database retrieval system