KEGG   Chroococcidiopsis thermalis: Chro_4542Help
Entry
Chro_4542         CDS       T02360                                 

Definition
Cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
cthe  Chroococcidiopsis thermalis
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Chro_4542
Enzymes [BR:cthe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Chro_4542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5107805..5109313
Genome map
AA seq 502 aa AA seqDB search
MTDIKAIVIGSGFGGAVAALRLGRAGVETLVLERGRRWTIEDPTKNATFATFRNPDRRAE
WLNTVTKTPGYEGIPIEKYTGVLEILERGDYKFLVGCGVGGGSLAYGGILIQPPQELFKQ
VFPSSINYDEMDAVYFPRVHSVIGSAPIPDDVLESEYYLGLKILEQHALKAGFPYVESTN
CGLINGVNRFPMGIDWDIVREEMVGKRVPSVIAAEFWFGNNSGGKKTLDRNYLKLAEETA
AVEIRTHHVVTKVAERPEGGYAVVVDIINDSGEVINQQTLTCEYLFMAAGVMGTCELLIK
AKAKGDLPKINDRIGQGFGNDGDTYAFRTNLSETTNPHLGGPGAIAVLNYDNPIFPCVMM
RAPLPRFERDFPNKNVIGSFVFAMTPYRGNFSYDPASDTVQLNFASDPKAKEAAKYLAEL
LSEKNGGEVPPIASQTTGHQLGGACMGQVCDDCGRVEGHSHLYVVDGALIPGSSTCVNPA
LTIAAIAERCLERILAEDIQHS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgactgatatcaaagcaattgtaatcggcagtggtttcggtggagcagtagctgcctta
cgcttaggacgagcaggagttgaaactcttgttttagagaggggacggcgctggacaatt
gaagatcctactaaaaatgcaacttttgcaacatttagaaatccagatagacgagcagag
tggctgaatacagtcacaaaaaccccaggttatgaaggaattccgattgaaaaatacacc
ggggtactcgaaattttagaaagaggagactacaagtttttagtcgggtgtggtgtgggt
ggtggttctttggcatatgggggaattttaattcaaccaccgcaggaactattcaagcag
gtgtttcctagctccattaactatgacgaaatggatgctgtttattttccccgagtccac
tctgttattggcagcgcccctattccagatgatgttctagaaagtgaatattacctggga
ttaaagatactggaacaacacgctctcaaggcaggattcccttatgtcgaatctaccaat
tgtggcttaatcaacggagttaatcgatttccaatgggaattgattgggatattgtccga
gaagaaatggtaggaaaaagagtgccatctgtgattgcagctgagttttggtttggcaat
aacagtggtggtaaaaaaacactggatcgaaactacctgaagttagctgaggaaacggct
gccgttgaaattcgcactcatcatgttgtcaccaaagttgcggaaagaccggaaggtggt
tatgcagttgtagtagacataattaacgactctggtgaagttattaaccaacaaacttta
acttgtgagtacctgttcatggctgctggtgtcatggggacttgcgaactcctaatcaaa
gctaaagctaagggagatttaccaaaaatcaacgatcgcataggacagggatttggcaac
gatggcgatacctatgcctttcgcaccaatctgtcagaaactaccaacccgcatttaggc
ggtccaggtgcgatcgctgttctcaattatgataatcccatctttccctgtgtgatgatg
cgagcgccattaccgagatttgaacgagattttccgaataaaaatgtcattggtagcttt
gtctttgctatgaccccttatcgaggcaactttagctacgacccagcttcagatacagtc
caattaaattttgccagcgaccccaaagccaaagaagctgctaagtatttagccgaactg
ctgagcgagaaaaatggtggcgaagtgcctccgattgcctctcagacgactggtcatcaa
ctgggaggagcctgtatgggtcaagtttgcgatgactgcgggcgcgtggaagggcattca
cacctatatgttgtcgatggtgctttaattccagggtctagtacctgtgtcaatccggca
ctaacaatcgcggcgatcgccgagcgttgtctagagcggattttggctgaggatattcaa
cattcatga

DBGET integrated database retrieval system