KEGG   Chroococcidiopsis thermalis: Chro_5139Help
Entry
Chro_5139         CDS       T02360                                 

Definition
Protein-L-isoaspartate(D-aspartate)O-methyltrans ferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cthe  Chroococcidiopsis thermalis
Brite
Enzymes [BR:cthe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Chro_5139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5766713..5767630
Genome map
AA seq 305 aa AA seqDB search
MSDVSARHYALVDRLKQQGFIRTPRIEAAFRSVPRHLFLPGVSIETAYTDEAIITKYLNG
KPISSASQPSIVAIMLEQLSVQEGDRVLEIGAGTGYNAALMDYLVGDRGQVVTLDIDPDV
VENACQHLLTAGCDRVQVICADGGFGYPAAAPYDRIILTVGAGDILPAWQQQLKPNGRLV
LPLTILKNVELTVAFDRVNSYWESDSAANCGFMKLRGAFAESQEKETNSKALDFKEVLIQ
VNNIYPLLEPLPLNLLLSLYNLINFGHASLKDLKIKAYSQEIEYMPKAKETVIDKNWTKL
VLSWQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgtatctgcacgacactacgcactagtcgatcgcctcaaacaacaaggcttc
attcgtactcctcgcatagaagctgcttttcgtagcgtaccgcgtcacttatttcttccc
ggcgtttcaatagaaacagcctacacagatgaagcgattattaccaaatacttgaacggc
aaaccaattagttctgcttcccagccatcaattgtggcaatcatgttagaacaactgagc
gtgcaagagggcgatcgtgtattagaaattggtgcgggaacaggttataatgctgctcta
atggattacttagttggagatcgaggtcaagttgttacccttgatatcgatcctgacgtt
gtagaaaatgcctgtcagcatttattgactgctggttgcgatcgcgtgcaagttatttgt
gctgatggcggttttggttatcctgctgctgcaccatacgatcggattattctcacagtt
ggcgctggggatattttacctgcttggcaacagcaattaaagcctaatggacggttggta
ttgcctctaaccattctaaaaaatgtagaactaactgttgctttcgatagagtaaatagt
tattgggaaagtgattctgctgcaaattgtggttttatgaaactacggggtgcttttgct
gagtcacaagaaaaggagacaaatagtaaggctttagattttaaagaagtactaattcaa
gttaataatatttatcctttgctcgaacctttacctctcaatttgttattaagtttatac
aatttaataaattttggtcatgcttccctgaaggatttgaagattaaagcttattctcaa
gaaattgagtacatgccaaaagcaaaggaaactgttattgataaaaattggacaaagctt
gtattgtcatggcagtaa

DBGET integrated database retrieval system