KEGG   Chroococcidiopsis thermalis: Chro_5254Help
Entry
Chro_5254         CDS       T02360                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cthe00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5898793..5899725
Genome map
AA seq 310 aa AA seqDB search
MLTQTDTSVIPFLGADVTASYDAAKVVILPIPYEATTTYRRGCENGPDAILEASQQVEYY
DEELDWEIGCDVGIYTYPSIADTRDRQVSAEEMLKSTQETVYQLIQDKKFVIALGGEHSI
TTGVVEAYRQAYPDEPFTVVQIDAHGDLRHEYEGSIHNHACIMRRVVDMGLPTVQIGIRA
ICKEEAELIKAKNLTVFRAREIANQPDWIEKAIAAIPTQKVFLTIDLDGIDPTLIPGVGT
PEPGGLNWYALLSFLRKVIEKHQVLGLDIMELAPVADSVVSQFTAAKLAYKLIGYQALVQ
DWKSNYSNSR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgctaactcaaacagatacttctgtcattccctttctcggtgctgatgttacagcaagt
tatgatgctgctaaagtcgttatcctaccgattccctacgaagcaacaacaacctatcgc
cgtggttgcgaaaatggtcccgatgcaattctagaagcttcacagcaagtggaatactat
gatgaagaacttgactgggagatcggttgcgatgtcggtatttatacgtacccttcaatt
gccgatactcgcgatcgccaagtttcagcagaagagatgctgaaatccactcaagaaaca
gtttaccagctaattcaagacaaaaaatttgtcattgctttaggtggcgaacatagcatt
acaacaggtgttgtcgaagcatatcgccaagcgtatccagacgaacctttcaccgtagtg
caaattgacgctcacggcgatctgcgccatgaatatgaaggctcgatccacaatcatgct
tgtattatgcggcgagtggttgatatgggtttaccaaccgtccaaattgggattcgagca
atttgcaaagaagaagccgaactgattaaagcgaaaaatctgactgtatttcgcgccaga
gaaattgctaatcaacccgattggattgaaaaagcgatcgccgctattccaactcaaaaa
gtctttcttaccatcgatctagacggtatcgatccaactttgattccaggggttgggact
cccgaaccaggcggattgaactggtatgctctgctttccttcttgagaaaagtcattgaa
aaacatcaagtccttggcttggatattatggaattagcaccagttgccgattcagtagtt
tcacagttcacggcagcgaaattagcgtataaactaatcggttatcaagcattagttcag
gactggaaaagtaactacagcaattctagatga

DBGET integrated database retrieval system