KEGG   Chroococcidiopsis thermalis: Chro_5333Help
Entry
Chro_5333         CDS       T02360                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Chro_5333
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Chro_5333
   00052 Galactose metabolism
    Chro_5333
   00500 Starch and sucrose metabolism
    Chro_5333
   00520 Amino sugar and nucleotide sugar metabolism
    Chro_5333
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Chro_5333
   00524 Butirosin and neomycin biosynthesis
    Chro_5333
Enzymes [BR:cthe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Chro_5333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5990401..5991438
Genome map
AA seq 345 aa AA seqDB search
MTILLAGDIGGTKTILRLVETTEATPKALYEQRYNSRDYPDLAPIVQEFLATSEEKLGKK
LLPQKACFAIAGPVVNNTVQLTNLTWLLEASRLEEELGIESISLINDFAAVGYGILGLQE
SDLHTLQAGKPQTGTPIAVIGAGTGLGQGFLIQQGDTYHVFSSEGGHADFAPRSELDFHL
LKYLLDKHDIQRVSVERVVSGQGIVAIYEFFRDRQNVKESPEIAQVVAAWEKQAGKKEKT
VDPAAAISKAALEKSDRLSERVMQIFVEAYGAEAGNLALKLLPYAGLYIAGGIAAKILPL
MQEGTFIRAFTSKGRMRPLLENVPVHIVLRSDIGLVGAAIAADRL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgacaatactgttagcaggagatattggtggcacgaagacgatcttgcgtttggtggaa
acaacagaagcaacacccaaagccctttacgaacaacgctataacagtcgcgactatcca
gatttagcgcccatagtccaagagtttttagccacatctgaggaaaagttgggcaaaaaa
ctcttaccgcaaaaagcttgttttgcgatcgcgggtccagttgttaacaatacagtacag
ttaaccaacctaacttggctgctagaagcatccaggctagaagaagagttggggatcgag
tccatttccctgatcaacgactttgccgctgttggttacggtatattgggtttgcaggaa
tcagatttacacactctccaagcaggtaagccccaaacaggtacgcccatcgcggtaatt
ggtgcaggaacgggattaggacagggatttttaattcagcaaggcgacacttaccatgtc
tttagttccgaaggcggacacgctgatttcgcacctcgttccgagttagactttcacctc
ttgaaatacctattggacaagcacgacatccaacgagtttcagtagaacgagtggtatcg
ggacaaggaattgtcgccatctacgaattttttcgcgatcgccaaaatgtgaaagaatcg
ccagaaattgcccaagttgtagcagcttgggaaaaacaagctggcaagaaagaaaaaacc
gtcgatccagccgccgcaatttccaaagccgccctagaaaaaagcgatcgcctgtcagaa
cgggtaatgcagatttttgttgaggcttacggcgcagaagcaggaaacctcgccctcaaa
ctcttaccgtatgcagggttatacattgctggtggtatcgctgcgaaaattcttccccta
atgcaagaaggtacttttatccgcgccttcaccagtaaaggacggatgcgacctttactc
gaaaacgttcccgtgcatatcgtcctgcgatcggacattgggctagttggtgctgcgatc
gccgcagatcgtttgtag

DBGET integrated database retrieval system