KEGG   Chroococcidiopsis thermalis: Chro_5534Help
Entry
Chro_5534         CDS       T02360                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cthe  Chroococcidiopsis thermalis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cthe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Chro_5534
Enzymes [BR:cthe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Chro_5534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6239115..6240167)
Genome map
AA seq 350 aa AA seqDB search
MNSIIVFGSINIDLVSKTPRLPLPGETLTGHSFVTAPGGKGANQAVAIAKLGVPSYMVGR
VGGDNFGRELLASLQAAGVRTENVLVDESISSGVAAIAVDDNGENQIIITPGANGRVDET
DVERLQSVLKILSRPPSQRKGTNSPPSQGGLGGSRPPSQGELEKSISPPSQGGLGGSILL
LQLEIPLSAVITAAQVAKAAGIQVILDPAPAQNLPDELYPLIDIITPNETEAGRLVGFTV
DGRETATEAARALLQKGVGNAIVKLGAKGVICATQAETFFTPAFSVTAVDTVAAGDAFNG
GLAAALVEGLPLRQAVVWGAAAGALAATKPGAQSAMCDRPTLEALMATGS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaactctattatcgtattcggtagtatcaatatcgatctagttagtaaaacacccaga
ttacctttacctggagaaactctgacgggacatagttttgtcaccgcgccagggggaaaa
ggcgcaaatcaagcagttgcgatcgccaaattgggcgttccctcatacatggtagggcgt
gttggcggagataatttcggtcgggaattattagcaagtctgcaagcggcgggagtacga
actgaaaatgtattggtggatgaaagtatcagttctggagtcgctgcgatcgcggttgat
gacaatggtgaaaaccaaattatcataactcctggggcaaatggacgagtcgatgagaca
gatgtagaacgtctccagagtgtattaaagatcctttctcgccccccttcccaaaggaag
ggaacaaatagccccccttcccaaggggggttggggggatctcgtcccccttcccaaggg
gagttagaaaaatctattagccccccttcccaaggggggttggggggatcgatcctactc
ctccaactagaaattcccctcagcgccgttattacagccgcccaagttgcaaaagcagcc
ggaattcaagtcattctcgatcctgcaccagcccaaaatttaccagacgaactttatccc
ttgatcgatatcatcaccccaaacgaaacagaagcagggcgattagttggctttactgta
gatggacgagaaactgcaaccgaagcagcacgggctttattgcaaaaaggtgtgggtaac
gcgatcgtcaaacttggtgctaagggtgtcatctgtgcgactcaagcagaaacatttttt
actcccgccttctccgtcacggctgtagatacggtagccgcaggagatgccttcaacggt
ggtttagctgcggcactagtagaaggactacccttgagacaagcagtagtatggggtgca
gcggcgggcgctttagctgcaaccaaaccaggggcgcagtctgcaatgtgcgatcgccct
actttggaggcattaatggcaactggatcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system