KEGG   Chaetomium thermophilum: CTHT_0001600Help
Entry
CTHT_0001600      CDS       T03100                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase-like protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
cthr  Chaetomium thermophilum
Brite
Enzymes [BR:cthr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     CTHT_0001600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 302 aa AA seqDB search
MPTTTEGLIPNWFPPNRENYDLILTLWKLFPFFSSLQWLIPWYGMGKTSIPHSPLNLPGR
LAWLTMEIPGFLTLLYHLYVLPSQLPLPPSPDGSLPWQTQTLAFLFVFHYIYRAILFPFL
QPSMSPVHLFIWLLGVTFQLVNGTVIGAWLAGYGPMYYNHSPAQTPISQFALGLIVFYLG
LASNYFHDDHLREIRRRVLRRQQLAAQKPDDSPDAPKSVEKHYEIPQAGLFKVVLYPHYL
SEWIEWVGYWIAAGWGCVPARCFVLNEVTAMLPRAVRGRQWYVERFGEETVGRRWAVIPG
VW
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcccacaacaacggagggtttgatccccaactggtttcccccgaatcgagagaactat
gacttgattctcactctctggaaattgttccccttcttctcctcccttcaatggctaatc
ccttggtacggcatgggcaaaacctccatccctcactccccgctcaacttgccaggccgc
ctcgcctggctaacaatggaaatccccggcttcctgaccctcctctatcacctctacgtc
ctcccctctcaactgccccttcctccctcccccgacggctccctcccctggcaaacacaa
accctcgccttcctctttgtatttcattatatctacagggctatcctcttccctttctta
cagccatccatgtcgccggtgcacttgttcatctggctcctcggcgtgacatttcaactg
gtgaatggtaccgtcatcggcgcctggctggctggctatgggccgatgtattacaaccat
tcccctgcacagacgcctatctcacagttcgcgctgggtctcatagtattttacctcggg
ctggcaagcaattacttccacgacgaccacctccgcgagatccggcgccgcgtcctccgc
cggcagcagttagctgctcagaagccagatgacagccccgacgcgccaaagtcagtggag
aagcactatgagataccgcaagcgggattgttcaaggtggtgctgtatccgcactatttg
agcgaatggattgagtgggttgggtactggatcgcggcggggtggggttgtgtgccggcg
aggtgttttgtgttaaatgaggttacggcgatgttgcctagggcggtgaggggacggcag
tggtatgtggagcgatttggagaggagacggttgggaggaggtgggctgttattccgggg
gtttggtaa

DBGET integrated database retrieval system