KEGG   Chaetomium thermophilum: CTHT_0029500Help
Entry
CTHT_0029500      CDS       T03100                                 

Definition
acyl-CoA desaturase 1-like protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cthr  Chaetomium thermophilum
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cthr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CTHT_0029500
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CTHT_0029500
Enzymes [BR:cthr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CTHT_0029500
Lipid biosynthesis proteins [BR:cthr01004]
 Desaturase
  First
   CTHT_0029500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 479 aa AA seqDB search
MASATTTSADVPHIAQAESFPDGTTDHIPLRKKAYDIRKPHISEQPWTWSNWYQHINWLN
TTFIIFIPLAGCVAAYWVPLQMKTLYFSIAYYFFAGLGITAGYHRLWAHSSYKARLPLKI
FLAAGGSAAVEGSARWWSSLHRSHHRYTDTDKDPYSVRKGLFYSHIGWMVVKQNPRRIGR
TDISDLNEDPVVVWQHRNYLKCVVTMALIVPTLICGLGWGDWAGGFIYAGILRIFFIQQA
TFCVNSLAHWLGDQPFDDRNSPRDHVITALVTLGEGYHNFHHEFPSDFRNAIEWYQYDPT
KWFIWLMKFVGLAYNLKTFPQNEIEKGRLQQMQKKLDQKRATLDWGTPLEQLPVLSWDEF
VAEAKNGRALVCIAGIIHDVGKFIQDHPGGKTLISSAIGKDATAVFNGGVYNHSNAAHNL
LSTMRVAVLRGGCEVEIWKRAQAESKDAVPVTDSTGNRIIRAGQQPTRVPQPVQTADAA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgcgaccaccacgtcggcggatgttccgcacatcgcccaggccgagtccttc
ccggacggcaccactgaccacattcccctccgcaagaaggcctacgacatccgcaagccg
cacatctcggagcagccgtggacatggtccaactggtatcagcacatcaactggctgaac
accactttcatcatcttcatccccctggccggctgtgttgccgcctactgggtccctctc
cagatgaagactttgtacttctccatcgcctactacttcttcgctggcctcggcatcact
gcgggctaccaccgtctctgggcccactccagctacaaggcccgtctccctctcaagatc
ttcctggctgctggtggctctgctgctgttgagggcagcgctcgctggtggtccagcttg
caccgttctcaccatcgctacaccgataccgacaaggatccctactcggtgcgcaagggt
ctgttctacagccacatcggctggatggttgttaagcagaaccctcgccgcatcggccgt
accgatatcagcgatctgaacgaggaccccgtcgtcgtctggcagcatcgcaactacctc
aagtgcgtcgtcactatggccctgatcgttcccacccttatctgcggcctcggctggggc
gactgggctggcggcttcatctatgccggcattctccgcatcttcttcatccagcaggcc
accttctgcgtcaacagcttggcccactggctcggcgaccagccattcgatgaccgcaac
tcgccccgcgaccacgtcatcactgccctggttaccctgggtgagggctatcacaacttc
caccacgagttccccagcgacttccgcaacgccatcgagtggtaccagtacgaccccaca
aagtggttcatctggctcatgaagttcgttggccttgcctacaatctcaagaccttcccc
cagaacgaaatcgagaagggccgtctccagcagatgcagaagaagctcgaccagaagcgc
gccaccctcgactggggcactcccctcgagcagctgcccgtcctctcctgggacgagttt
gtcgccgaggccaagaacggcagggccctcgtctgcattgctggcatcatccacgacgtc
ggcaagttcatccaggaccatcctggtggcaagaccctcatctcgtccgctattggcaag
gacgccactgccgtcttcaacggtggtgtctacaaccactccaacgccgcccacaacctg
ctctcgaccatgcgtgtggccgtcctccgcggcggctgcgaggtcgagatctggaagcgc
gcccaggccgagagcaaggacgctgtccccgtcaccgactcgactggcaaccgcatcatc
cgcgctggccagcagcccactcgggttcctcagcccgtacagactgccgatgctgcttaa

DBGET integrated database retrieval system