KEGG   Chaetomium thermophilum: CTHT_0061160Help
Entry
CTHT_0061160      CDS       T03100                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cthr  Chaetomium thermophilum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cthr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CTHT_0061160
Enzymes [BR:cthr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CTHT_0061160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 643 aa AA seqDB search
MALAQTKAAIAASIGLRILTYIFLRWALVPAAPAIIFTLFAVYLPSFISGYRKEPKYEMV
DEVDMVVKETTAPKEETSKKERFQAPSVTKQTTVKDVTIKETISFEDRPLNPLKTLLSGA
PNPRSLALSATSLLVNLLCVVMVADRLFRDQFLHTVDDLSFARVGYVSENEARLLIREPD
QHKMPITVEVRIKDPQPPFDSPLWHNVGGVRWTTNETDYTAVIPIPLPRSKRRVFEWRTS
NNHSGTFTTPSPVGKADDTNYGPFTFVTTSCIVPRLPYSPFDHPLAIPGFRHLAKVLPTL
GAQFMLFLGDFIYSDVPRYWGRDVGYYRQKYRQVYASPDWPAVGQNLSWIHVLDDHEIAN
DWSANSTGVYATAVDPFHNYHSAANPPPANMKAGRPTYFTFTQGPATFFLLDTRSFRSAN
HLLPADHPDKTMLGKEQLQALLAWLRRSEPKGVKWKIVASSVPFTKNWHVDSLDTWAGFL
HERQTILKTMWEVGRTQGVGVVVLSGDRHEFAATKFPPPFSDETHPVEGVKDPDEAKKSS
HESAAVWEFSVSPLSQFYSPVPSYWQSDAEDVMIKYIHKGNSKFGAVTIENLESGHQSSL
KYRLYVDGKEVWNTVILSPPPASGSGSNGISGLLGNLRNKIGV
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggcactcgcgcagaccaaggctgcgatagcagcctcaatcggtctgcgcattctgact
tacatcttcctgcgatgggctcttgttcccgctgctcctgctatcatattcaccctcttt
gcggtctacctcccttccttcatatcgggctaccgcaaagagccaaagtatgagatggtc
gatgaggtcgacatggtggtgaaagagaccacagctcctaaggaagagacctccaagaag
gagagattccaggcgccgagtgtcaccaagcagaccacagtcaaggacgttaccatcaaa
gagactatttccttcgaggataggcctcttaaccccctcaaaaccctgctgagtggtgct
cctaacccacgtagcttggctctttcagcgacttcgctgctggtgaacctgctctgtgtt
gttatggttgcggaccgcctgttccgggaccagttcttgcatacggttgacgatctctct
tttgcgagggtcggctacgtgtcggagaatgaggccaggctcttgatccgtgagccagat
cagcacaagatgcccattactgtggaagttcgaatcaaggacccacagccgccttttgac
agtcccttgtggcacaatgttgggggtgtaagatggacaaccaacgaaaccgactacaca
gctgtcatcccaatcccgctcccacggtccaagcggcgggtcttcgaatggcgcacctcg
aacaaccactcaggtacatttacaactccttctccagtcggcaaggctgatgacaccaac
tatggacctttcaccttcgtcaccacctcttgtatcgttcctcggctgccatatagtcca
tttgatcacccactcgctattccgggctttcgacatctggccaaagtgcttcctacactg
ggtgctcagttcatgctctttcttggagactttatctactcagacgtgccgcgctactgg
ggtcgcgatgtaggctactatcggcagaagtaccgtcaggtttatgcctcaccggactgg
ccagcagtgggacaaaatctcagctggattcatgtccttgacgatcatgagatagcaaat
gactggtctgccaactcaactggcgtttacgcgaccgctgtcgaccccttccacaactac
cattccgccgccaaccccccaccagccaacatgaaggcaggaagaccaacttactttacc
ttcacccaaggcccggcgaccttcttccttctagatacccgctctttccgctcagcgaac
catctacttcctgctgatcatccggacaaaacgatgttgggcaaggagcaactgcaggca
ctgcttgcatggcttcgtcgctcggaacctaagggggttaagtggaagattgtggcgtcc
tcggtcccttttaccaaaaattggcacgtcgattctctcgatacgtgggccggctttcta
cacgaaagacaaacgatcttgaagaccatgtgggaggtgggcagaacccaaggtgttggt
gtcgttgtgctgagtggtgaccggcacgagtttgcggctacgaaattccctcctcctttc
tcggacgagacccatcctgtcgaaggggtgaaggacccagatgaggcgaagaaaagttct
catgaaagtgcggctgtatgggagttttctgtcagtccgctcagccaattctactcacct
gtcccttcatattggcagagtgatgctgaggatgtgatgataaagtacattcataaagga
aactcaaagtttggtgcagttacaatcgaaaacctagagagcggccaccaaagtagcctt
aagtacaggttgtatgtagatggaaaggaagtatggaacaccgtcatcctgtccccgcca
cccgcttcgggatcgggaagtaacgggatcagcggccttctaggaaatttgaggaacaag
attggggtatga

DBGET integrated database retrieval system