KEGG   Cupriavidus taiwanensis: RALTA_A0102Help
Entry
RALTA_A0102       CDS       T00702                                 

Gene name
argS
Definition
arginyl-tRNA synthetase (EC:6.1.1.19)
Orthology
K01887  
arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
cti  Cupriavidus taiwanensis
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:cti00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:99122..100909
Genome map
AA seq 595 aa AA seqDB search
MLPVQTSNLAAAFTDAVRALAPADATLPAVTFERPKVAAHGDLACNVAMQVARALKSNPR
ELAQRIVAAVEADARAQGLVAGMDIAGPGFINLRLTPSAKADVLRAVLNEGDHYGARERG
VHGQVLVEFVSANPTGPLHVGHGRQAALGDALANLLSWQGWHVHREFYYNDAGVQIQTLA
LSVQARARGLKPGDASWPEAAYNGDYIADIAADFLAGKTVSASDGEPVTASGNVEDIDSI
RKFAVTYLRNEQDIDLQAFGVKFDRYYLESSLYSDGRVDAAVQSLIDKGKTYESEGALWL
RTTDDGDDKDRVMKKSDGTYTYFVPDVAYHTTKWERGFTKVINVQGSDHHGTIARVRAGL
QGLDIGIPQGYPDYVLHKMVTVMKNGEEVKISKRAGSYVTVRDLIEWSNGGDETIRGCLE
QGVADWPAHFTRGRDAVRFFLLSRKADTEFVFDVDLALKQNDENPVYYVQYAHARICSIF
ESWGGADWESRLAELAGADLSAVTGADASAQALALGRRLAEFPDMLAAAAAELAPHAVAF
YLRDLAGDFHAFYNADRVLVDDEAVKRARLALLAATRQVLRNGLAVIGVSAPRRM
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgctgcctgttcagacctccaatcttgccgccgcgttcaccgatgccgtgcgcgcgctc
gccccggccgacgccaccttgcccgccgtcaccttcgagcggcccaaggtagccgcccat
ggcgaccttgcctgcaatgtggccatgcaggtcgcgcgcgcactcaagagcaatccgcgc
gagctggcgcagcgcatcgtcgccgccgtcgaggccgatgcccgcgcgcaaggcctggtc
gcgggcatggacatcgccggtcccggcttcatcaacctgcgcctgacgccgtcggccaag
gccgacgtgctgcgcgcggtgctgaacgagggcgaccactacggcgcgcgcgagcgcggc
gtgcatggccaggtgctggtggaattcgtctcggccaacccgaccggtcccctgcacgtc
ggccacggccgccaggcggcgctgggcgatgcgctcgccaacctgctgtcgtggcagggc
tggcacgtgcaccgcgagttctactacaacgacgccggcgtgcagatccagaccctggcg
ctgtcagtgcaggcgcgcgcgcgcggcctcaagccgggcgatgccagctggccggaggcc
gcctacaacggcgattacatcgccgacatcgccgccgacttcctcgccggcaagaccgtc
agcgcctcggacggcgagccggtgaccgcgtcgggcaacgtcgaggacatcgactcgatc
cgcaagttcgccgtgacctacctgcgcaacgagcaggacatcgacctgcaggccttcggc
gtgaagttcgaccgctattacctggagtcgtcgctgtacagcgacggccgcgtcgacgcc
gcggtgcagtcgctgatcgacaagggcaagacctacgaaagcgagggcgcgctgtggctg
cgcaccaccgacgacggcgacgacaaggaccgcgtgatgaagaagagcgacggcacctat
acgtacttcgtgccggacgtggcctaccacaccaccaagtgggagcgcggcttcaccaag
gtcatcaacgtgcagggcagcgaccaccacggcaccatcgcgcgcgtgcgcgccggcctg
cagggcctggacatcggcatcccgcagggctatcccgactacgtgctgcacaagatggtg
accgtgatgaagaacggcgaggaggtcaagatctccaagcgcgccggctcctacgtcacc
gtgcgcgacctgatcgaatggtccaacggcggtgacgagaccatccgcggctgcctggaa
cagggcgtggccgactggcccgcgcacttcacgcgcgggcgcgacgcggtgcgcttcttc
ctgctgtcgcgcaaggccgataccgagttcgtcttcgatgtcgacctggcgctcaagcag
aacgacgagaacccggtgtactacgtccagtacgcccacgcccgcatctgctcgatcttc
gagtcgtggggtggcgcggactgggaaagccggctggccgagctggccggggccgacctg
tccgcggtgaccggcgccgacgccagcgcgcaggcgctggcactgggccgccgcctggcc
gagttccccgacatgctggccgccgccgcggccgagctggcgccgcacgcggtggccttc
tacctgcgcgacctggccggcgacttccacgccttctacaacgccgaccgcgtgctggtc
gacgacgaagccgtcaagcgcgcccgcctggcgctgctggccgccacgcgccaggtgctg
cgcaacggcctggcggtgatcggggtgtccgccccgcgccgcatgtag

DBGET integrated database retrieval system