KEGG   Cupriavidus taiwanensis: RALTA_A0318Help
Entry
RALTA_A0318       CDS       T00702                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methylerythritol kinase (EC:2.7.1.148)
  KO
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cti  Cupriavidus taiwanensis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RALTA_A0318 (ispE)
Enzymes [BR:cti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     RALTA_A0318 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(318220..319098)
Genome map
AA seq 292 aa AA seqDB search
MPSSHPLPPPELRDCPAPAKLNLFLHVTGRRADGYHTLQTVFQLVDWCDMLHFRRRDDGV
VARVTEVPGVPAESDLVVRAARALQAATGTTFGAEIAIDKVLPMGGGIGGGSSDAATTLL
ALNHLWGLGLTRPELMRIGLTLGADVPVFVLGQNAFAQGIGEELTPVELPDSWFVIIHPK
QHVPTAEIFSDECLTRDTPVSIIAVFAARTNKFDFGRNDLEPIATAKFGEVARALAWLKQ
HNQHARMTGSGACVFARFPDAKTAQQVLERLPPEWDGRCVRSLAHHPLAAFA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgccaagcagccatcccctgcccccacccgaactgcgcgactgccccgcgccggccaag
ctcaacctgttcctgcacgtgaccggccgccgcgccgacggctaccacacgctgcagacc
gtgttccagctggtcgactggtgcgacatgctgcatttccgccgccgcgacgacggcgtg
gtcgcgcgcgtcacggaggtgccgggcgtacccgccgagagcgacctggtggtgcgggcg
gcgcgcgccctgcaggccgccaccggcaccaccttcggcgccgagatcgccatcgacaag
gtgctgccgatgggcggcggcatcggcggcggctcgtccgatgccgcgaccacgctgctg
gcgctgaaccatctgtggggcctggggctgacgcgccccgagctgatgcggatcgggctg
acgctgggcgcagacgtgccggtgttcgtgctcgggcagaacgcctttgcgcagggcatc
ggcgaggagctcacgccggtcgagctgccggacagctggttcgtgatcatccatccgaag
cagcacgtgccgaccgctgaaattttttcggacgagtgcttgacaagggatacgcccgtc
tccataattgcggtcttcgctgctcgcacaaacaaattcgatttcggtcgcaacgacctg
gaaccgatagcaacagcgaagttcggcgaagtcgcccgagccctggcatggctgaagcaa
cacaatcagcatgcccggatgaccggttccggagcctgcgtgtttgcgcgttttcccgac
gccaagacagcgcagcaggttttggaaaggttgcctcccgaatgggatggcaggtgtgtg
agaagtctggcacatcacccgctcgcagcgttcgcatag

DBGET integrated database retrieval system