KEGG   Cupriavidus taiwanensis: RALTA_A0481Help
Entry
RALTA_A0481       CDS       T00702                                 

Gene name
lnt
Definition
apolipoprotein n-acyltransferase (EC:2.3.1.-)
Orthology
K03820  
apolipoprotein N-acyltransferase [EC:2.3.1.-]
Organism
cti  Cupriavidus taiwanensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(489692..491305)
Genome map
AA seq 537 aa AA seqDB search
MKLPAPLPDGAAADAGTAGVPGARAQSRAAMLARLLLAGVLGIAHTQAFAPHDWWWLQIL
SLAGLAALIADAPRTRAAGAIGYAFGLGWFLSGIWWLYISMHVYGEMPSWMAALAVLLFS
GFLSLYPALAGAFWHRLTARLPAGTLLAPLAFGAAWGLSEWLRGVVFTGFPWLSGGYAHA
DGPLAGYAPVLGVYGIGALAAAVAALLAAAVRGLGRGERGRALGALALAGLVPAAGAALA
PLAWTTPAGKPLTVRLLQGNVAQDIKFEPVGIQRSIELYRDMITAAPADLVVTPETAFPV
ILQELPVEVAVAVRDYALTSGTTVLFGAAGADSPVDFTNSVFGLGPETERLYRYNKHHLV
PFGEFIPLGFRWFVDMMKMPLGDFRRGGLDQASLPVRGVRVAPNICYEDLFGEEIAQTLR
QQPAPANLLANLTNLAWFGDTIALDQHLQISRMRALETRRPMLRSTNTGMTAVVRPDGTV
QQRLPTFTVGTLTAEVQGMHGLTPYIRWGNAPVLALIALVLGMAAWRARRAGGRRRG
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcccgccccgctccccgacggcgccgcagccgacgccggcacggcgggcgtg
cccggcgcgcgcgcgcagtcgcgcgccgcgatgctggcgcgcctgctgctggccggcgtg
ctcggcatcgcccatacccaggccttcgccccgcatgactggtggtggctgcagatcctg
tcgctggcaggcctggccgcgctgatcgccgatgccccgcgcacgcgcgcggccggcgcg
atcggctatgccttcgggctgggctggttcctgtccggcatctggtggctctatatcagc
atgcacgtgtacggcgagatgccgtcgtggatggccgcgctggcggtgctgctgttctcg
ggcttcctgtcgctctacccagcgctggccggcgcgttctggcaccggctgacggcgcgc
ctgcccgcgggcacgctgctggcgccgctggcgttcggtgcagcgtggggcctgagcgaa
tggctgcgcggcgtggtgttcaccggctttccgtggctgtcgggcggctatgcgcacgcc
gacggcccgctggcggggtacgcgccggtgctgggcgtgtatggcatcggcgcgctggcc
gccgcggtggcggcgctgctcgccgccgccgtgcgcgggctaggccgtggcgaacggggc
cgcgcgctgggcgcgctggcgctggccgggctggtgcccgccgccggcgcggcgctggcg
ccgctggcctggaccacgcccgcgggcaagccgctgacggtgcggctgctgcagggcaac
gtggcgcaggacatcaagttcgagcccgtgggcatccagcgctcgatcgagctgtaccgc
gacatgatcaccgcggcgcctgccgacctggtggtgacgcccgaaaccgcgttcccggtg
atcctgcaggagctgccggtcgaggtggccgtcgccgtgcgcgactacgcgctcaccagc
ggcaccacggtgctgtttggcgccgccggcgccgattccccggtcgacttcaccaacagc
gtgttcggcctggggccggaaaccgagcgcctgtaccgctacaacaagcaccacctggtg
ccgttcggcgaattcatcccgctgggcttccgctggttcgtcgacatgatgaagatgccg
ctgggcgacttccgccgcggcgggctggaccaggcctcgctgccggtgcggggcgtgcgc
gtggcgccgaacatctgctacgaggatttgttcggcgaagaaatcgcgcagacgctgcgc
cagcagccggcgccggccaacctgctggccaacctgaccaacctggcgtggttcggcgac
accatcgcgctggaccagcacctgcagatctcgcgcatgcgggcattggaaacgcgccgt
ccgatgctgcgctcgaccaataccggcatgaccgcggtggtgcgcccggacggcacggtg
cagcaacgcctgccgaccttcaccgtcggcacgctgacggccgaggtgcagggcatgcac
gggctgacgccctatatccgctggggcaacgcgccggtgctggcgctgatcgcgctggtg
ctgggaatggcggcgtggcgcgcgcgccgggcaggcgggcgcaggcgcggctga

DBGET integrated database retrieval system