KEGG   Cupriavidus taiwanensis: RALTA_A0502Help
Entry
RALTA_A0502       CDS       T00702                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00020  Citrate cycle (TCA cycle)
cti00640  Propanoate metabolism
cti00660  C5-Branched dibasic acid metabolism
cti01100  Metabolic pathways
cti01110  Biosynthesis of secondary metabolites
cti01120  Microbial metabolism in diverse environments
cti01130  Biosynthesis of antibiotics
cti01200  Carbon metabolism
Module
cti_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cti_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RALTA_A0502 (sucC)
   00640 Propanoate metabolism
    RALTA_A0502 (sucC)
   00660 C5-Branched dibasic acid metabolism
    RALTA_A0502 (sucC)
Enzymes [BR:cti01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RALTA_A0502 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: CAP63170
UniProt: B2AHC1
Position
1:513686..514852
Genome map
AA seq 388 aa AA seqDB search
MNIHEYQGKEILRKYNVPVPRGIPAFSVDEALKAAEQLGGPVWVVKAQIHAGGRGKGGGV
KVAKSMDEVKTYASNILGMQLVTHQTGPEGKKVNRLLIEEGADIKKELYVSLVVDRVSQK
IALMASSEGGMDIEEVAAHTPEKIHTLIIEPSTGLTDADADDIARKIGVPDASVAQARQA
LQGLYKAFYETDASLAEINPLILTGDGKVIALDAKFNFDSNALFRHPEIVAYRDLDEEDA
NEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPNVQAILVNIFGGIMRCDVIAEGVISASKAVSLNVPLVVRMKGTNEELGRKM
LADSGLPIISADTMEEAAQKVVAAAAGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtatcaaggcaaggaaatcctgcgcaaatacaatgtgccggttccg
cgcggcatccccgcgttctcggttgacgaggccctgaaggccgcagaacaactcggcggc
ccggtgtgggttgtcaaggcgcagatccacgcgggtggccgcggcaagggcggcggcgtc
aaggttgccaagagcatggacgaggtcaagacctacgcgtccaacatcctgggcatgcag
ctggtcacgcaccagaccggtccggaaggcaagaaggtcaatcgcctgctgatcgaagaa
ggcgccgacatcaagaaggaactgtacgtttcgctggtggtggaccgcgtttcgcagaag
atcgcgctgatggcgtcgagcgaaggcggcatggacatcgaggaagtcgctgcccacacc
ccggaaaagatccacacgctgatcatcgagccgtcgaccggcctgaccgatgctgacgcc
gacgacatcgcccgcaagatcggcgtgcccgacgcgagcgtggcgcaagcccgccaggcc
ctgcaaggcctgtacaaggcgttctacgaaacggatgcttcgctggccgaaatcaacccg
ctgatcctgaccggcgacggcaaggtgatcgcgctggacgccaagttcaacttcgactcg
aacgcgctgttccgtcatccggaaatcgtcgcctaccgcgacctggatgaagaagacgcc
aacgaaatcgaagcctcgaagttcgacctggcctacatctcgctggacggcaacatcggc
tgcctggtgaacggcgccggcctggccatggccaccatggacaccatcaagctgttcggc
ggcgagccggccaacttcctcgacgtgggcggcggtgccaccaccgagaaggtgaccgaa
gccttcaagctgatgctgaagaacccgaacgtgcaggccatcctggtcaacatcttcggc
ggcatcatgcgttgcgacgtgatcgccgagggcgtgatctcggcctcgaaggccgtgtcg
ctgaacgtgccgctggtcgtgcgcatgaagggcaccaacgaagaactgggccgcaagatg
ctggctgactcgggcctgccgatcatctcggccgacacgatggaagaagccgcccagaag
gtcgtggctgccgccgccggcaagtaa

DBGET integrated database retrieval system