KEGG   Cupriavidus taiwanensis: RALTA_A0950Help
Entry
RALTA_A0950       CDS       T00702                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00230  Purine metabolism
cti01100  Metabolic pathways
Module
cti_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RALTA_A0950 (gmk)
Enzymes [BR:cti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RALTA_A0950 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 RsgA_GTPase MMR_HSR1 AAA_22 ABC_tran AAA_16 AAA_29 Septin AAA_23 DUF3987 AAA_25 Dynamin_N AAA_18 Viral_helicase1 cobW DUF5053 GTP_EFTU
Motif
Other DBs
NCBI-ProteinID: CAQ68917
UniProt: B3R3N4
Position
1:966584..967246
Genome map
AA seq 220 aa AA seqDB search
MSPTSQTAPHTAIDTVYPGNLFMVVAPSGAGKSTLVNALLAQDPAIRLSISHTTRAPRPG
EEDGREYHFVTVDAFRAARDRGDFLEWAEVHGNYYATSRVWIEQQMAQGNDVLLEIDWQG
AQQVHQRFSNAVEIFILPPSLTALEERLKKRGQDEPNVIVRRLLAAGSEMAHASESDYVI
INEVFDDALEQLRNVVNATRLRFSSQKARHAELFIELGIH
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagcccaacgtctcaaactgcgcctcacacggccatcgacaccgtctaccccggcaac
ctcttcatggtggtggcaccctcgggcgcgggcaagtcgacgctggtcaacgcgctgctg
gcgcaggacccggccatccgcctgtcgatctcgcacaccacgcgcgcgccgcgcccgggc
gaagaggacggccgcgagtaccacttcgtcacggtagacgccttccgcgcggcgcgcgac
cgcggcgacttcctggaatgggccgaggtgcacggcaactactacgcgacctcgcgcgtg
tggatcgagcagcagatggcgcagggcaacgacgtgctgctggaaatcgactggcagggc
gcgcagcaggtgcaccagcgcttttccaacgcggtggagatcttcatcctgccgccgtcg
ctgaccgcgctggaagagcgcctgaagaagcggggccaggacgagcctaacgtgatcgtg
cgccggctgctggcagcgggcagtgaaatggcgcacgcgtcggagtcggactacgtgatc
atcaacgaggtgttcgacgatgcgctggagcagttgcgcaacgtcgtcaacgctacgcgg
ctgcggttttcctcgcagaaggcgcggcacgcggagctgttcatcgagcttggcatccac
tga

DBGET integrated database retrieval system