KEGG   Cupriavidus taiwanensis: RALTA_A1032Help
Entry
RALTA_A1032       CDS       T00702                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cti  Cupriavidus taiwanensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RALTA_A1032 (tpiA)
   01230 Biosynthesis of amino acids
    RALTA_A1032 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RALTA_A1032 (tpiA)
   00051 Fructose and mannose metabolism
    RALTA_A1032 (tpiA)
   00562 Inositol phosphate metabolism
    RALTA_A1032 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RALTA_A1032 (tpiA)
Enzymes [BR:cti01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RALTA_A1032 (tpiA)
Exosome [BR:cti04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RALTA_A1032 (tpiA)
  Exosomal proteins of bladder cancer cells
   RALTA_A1032 (tpiA)
  Exosomal proteins of melanoma cells
   RALTA_A1032 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1056137..1056880
Genome map
AA seq 247 aa AA seqDB search
MRQKLVIGNWKMHGSLAANAALLEGIQAGAGVARATLAVCAPFPYLAQCQALLNGSKVAW
GAQDVSAEARGAFTGEVAASMLGEFGCTYVLVGHSERRTYHGETDQAVAAKALRALEFGI
VPVVCVGETLAQREAGETEAVVGRQLQAVLEALTVEQLGRVVLAYEPVWAIGTGKTATSE
QAQAVHAFLRGQVAARDAGVAGRMAILYGGSVKPDNAAELFSMTDIDGGLIGGASLKSED
FLAIGNA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtgagacaaaagctcgtcatcggcaattggaagatgcacggcagcctagctgccaacgcg
gctctgctggaaggcatccaggctggcgcgggtgtggcccgcgcgacgctggcagtctgc
gcgccgttcccctatcttgcacaatgccaggcgctgctgaatggctcgaaggtggcctgg
ggtgcacaggacgtgtcagcggaagcgcgcggcgccttcaccggcgaagtggcggcctcc
atgctgggggagttcggctgcacctatgtgctggtcggccactccgagcgccgcacctac
catggcgagaccgaccaggccgtcgcggccaaggcgctgcgcgcgctggaattcggcatc
gtcccggtggtctgcgtgggcgagacgctggcccagcgcgaggcgggcgagaccgaggcc
gtggtcggcaggcagctgcaggcggtgctcgaagccctgaccgtggagcaactcggccgc
gtggtgctggcttatgagccggtctgggccatcggtaccggcaagactgccaccagcgag
caggcgcaggcggtgcatgccttcctgcgcggccaggttgccgcgcgcgatgcgggcgtg
gccgggcgcatggcaatcctgtacggcggcagcgtcaagcccgacaatgcggccgaactg
ttttcgatgaccgatatcgacgggggcctgattggcggcgcctcgctcaagtcggaagat
tttctcgcgatcggcaacgcctga

DBGET integrated database retrieval system