KEGG   Cupriavidus taiwanensis: RALTA_A1032Help
Entry
RALTA_A1032       CDS       T00702                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00010  Glycolysis / Gluconeogenesis
cti00051  Fructose and mannose metabolism
cti00562  Inositol phosphate metabolism
cti00710  Carbon fixation in photosynthetic organisms
cti01100  Metabolic pathways
cti01110  Biosynthesis of secondary metabolites
cti01120  Microbial metabolism in diverse environments
cti01130  Biosynthesis of antibiotics
cti01200  Carbon metabolism
cti01230  Biosynthesis of amino acids
Module
cti_M00002  Glycolysis, core module involving three-carbon compounds
cti_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RALTA_A1032 (tpiA)
   00051 Fructose and mannose metabolism
    RALTA_A1032 (tpiA)
   00562 Inositol phosphate metabolism
    RALTA_A1032 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RALTA_A1032 (tpiA)
Enzymes [BR:cti01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RALTA_A1032 (tpiA)
Exosome [BR:cti04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RALTA_A1032 (tpiA)
  Exosomal proteins of bladder cancer cells
   RALTA_A1032 (tpiA)
  Exosomal proteins of melanoma cells
   RALTA_A1032 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAQ68997
UniProt: B3R3W5
Position
1:1056137..1056880
Genome map
AA seq 247 aa AA seqDB search
MRQKLVIGNWKMHGSLAANAALLEGIQAGAGVARATLAVCAPFPYLAQCQALLNGSKVAW
GAQDVSAEARGAFTGEVAASMLGEFGCTYVLVGHSERRTYHGETDQAVAAKALRALEFGI
VPVVCVGETLAQREAGETEAVVGRQLQAVLEALTVEQLGRVVLAYEPVWAIGTGKTATSE
QAQAVHAFLRGQVAARDAGVAGRMAILYGGSVKPDNAAELFSMTDIDGGLIGGASLKSED
FLAIGNA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtgagacaaaagctcgtcatcggcaattggaagatgcacggcagcctagctgccaacgcg
gctctgctggaaggcatccaggctggcgcgggtgtggcccgcgcgacgctggcagtctgc
gcgccgttcccctatcttgcacaatgccaggcgctgctgaatggctcgaaggtggcctgg
ggtgcacaggacgtgtcagcggaagcgcgcggcgccttcaccggcgaagtggcggcctcc
atgctgggggagttcggctgcacctatgtgctggtcggccactccgagcgccgcacctac
catggcgagaccgaccaggccgtcgcggccaaggcgctgcgcgcgctggaattcggcatc
gtcccggtggtctgcgtgggcgagacgctggcccagcgcgaggcgggcgagaccgaggcc
gtggtcggcaggcagctgcaggcggtgctcgaagccctgaccgtggagcaactcggccgc
gtggtgctggcttatgagccggtctgggccatcggtaccggcaagactgccaccagcgag
caggcgcaggcggtgcatgccttcctgcgcggccaggttgccgcgcgcgatgcgggcgtg
gccgggcgcatggcaatcctgtacggcggcagcgtcaagcccgacaatgcggccgaactg
ttttcgatgaccgatatcgacgggggcctgattggcggcgcctcgctcaagtcggaagat
tttctcgcgatcggcaacgcctga

DBGET integrated database retrieval system