KEGG   Cupriavidus taiwanensis: RALTA_A1359Help
Entry
RALTA_A1359       CDS       T00702                                 

Gene name
bktB
Definition
(GenBank) acetyl-CoA acetyltransferase, thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cti  Cupriavidus taiwanensis
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RALTA_A1359 (bktB)
   00630 Glyoxylate and dicarboxylate metabolism
    RALTA_A1359 (bktB)
   00640 Propanoate metabolism
    RALTA_A1359 (bktB)
   00650 Butanoate metabolism
    RALTA_A1359 (bktB)
  Lipid metabolism
   00071 Fatty acid degradation
    RALTA_A1359 (bktB)
   00072 Synthesis and degradation of ketone bodies
    RALTA_A1359 (bktB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RALTA_A1359 (bktB)
   00310 Lysine degradation
    RALTA_A1359 (bktB)
   00380 Tryptophan metabolism
    RALTA_A1359 (bktB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RALTA_A1359 (bktB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RALTA_A1359 (bktB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RALTA_A1359 (bktB)
Enzymes [BR:cti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RALTA_A1359 (bktB)
Exosome [BR:cti04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RALTA_A1359 (bktB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:1403098..1404282
Genome map
AA seq 394 aa AA seqDB search
MTREVVVVSGVRTAIGTFGGSLKDVAPAELGALVVREALARAQVSGDDVGHVVFGNVIQT
EPRDMYLGRVAAVNGGVSINAPALTVNRLCGSGLQAIVSAAQTILLGDADVAIGGGAESM
SRAPYLAPAARWGARMGDAGLVDMMLGALHDPFHRIHMGVTAENVAREYDISRTQQDEAA
LESHRRASAAIKAGYFKDQIVPVVTKGRKGEVTFDTDEHVRHDATMDDMTKLKPVFVKEN
GTVTAGNASGLNDAAAAVVMMERAEAERRGLKPLARLVSYGHAGVDPKTMGIGPVPATKI
ALERAGLQVSDLDVIEANEAFAAQACAVSKALRLDPAKVNPNGSGISLGHPIGATGALIT
VKALHELQRVQGRYALVTMCIGGGQGIAAIFERI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtgaagtcgtagtagtgagcggtgtccgcaccgcgatcgggacctttggcggc
agcctgaaggacgtggcgccggccgaactgggcgcgctggtcgtgcgcgaggcgctggcc
cgcgcgcaggtgtcgggcgacgacgtcggccatgtggtgttcggcaacgtgatccagacc
gagccgcgcgacatgtacctgggccgcgtcgcggccgtcaacggcggcgtttccatcaac
gctccggcgctgaccgtcaaccggctgtgcggctcgggcctgcaggccatcgtcagcgcc
gcgcagaccatcctgctgggcgatgccgacgtcgccatcggcggcggtgccgaaagcatg
agccgcgccccgtacctggctccggcggcacgctggggcgcgcgcatgggcgacgccggc
ctggtcgacatgatgctgggcgcgctgcacgacccgttccaccgcatccacatgggcgtg
accgccgagaacgtggccagggaatacgacatctcgcgcacgcaacaggacgaggccgcg
ctggaatcgcaccgccgcgcttccgccgcgatcaaggccggctacttcaaggaccagatc
gtcccggtggtgaccaagggccgcaagggcgaggtcaccttcgacaccgacgagcacgtg
cgccacgatgccaccatggacgacatgaccaagctcaagccggtcttcgtcaaggaaaac
ggcaccgtcaccgccggcaatgcctcgggcctgaacgatgccgccgccgcggtggtgatg
atggagcgcgccgaggccgagcgccgcggcctgaagccgctggcgcgcctggtgtcgtac
ggccatgccggcgtcgaccccaagaccatgggcatcggcccggtgccggcgacgaagatc
gcgctggagcgtgccggcctgcaggtgtcggacctggacgtgatcgaagccaacgaggcc
tttgccgcgcaggcctgcgcggtcagcaaggcgcttcggctggacccggccaaggtcaac
ccgaacggttccggcatctcgctgggccacccgattggcgccaccggcgcgctgatcacg
gtcaaggcgctgcacgagctgcaacgcgtgcaaggccgctacgcgctggtgacgatgtgc
atcggcggcgggcagggcattgccgccatcttcgaacggatctga

DBGET integrated database retrieval system