KEGG   Cupriavidus taiwanensis: RALTA_A1468Help
Entry
RALTA_A1468       CDS       T00702                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19 3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cti  Cupriavidus taiwanensis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    RALTA_A1468 (pncA)
Enzymes [BR:cti01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     RALTA_A1468 (pncA)
    3.5.1.-  
     RALTA_A1468 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1527103..1527747
Genome map
AA seq 214 aa AA seqDB search
MDTTLRPDDCLLVIDVQNDFMPGGALAVPNGDEVVPVINRLARAFGHVVLTQDWHPAAHV
SFAANHAGTQPFQMLTLPYGEQVLWPVHCVQDTPGAALHAGLHVPHARLLIRKGHHAGVD
SYSAFMEADRITRTGLAGYLREHGVQRVFCAGLATDYCVAWSALDARAAGFEAAVVEDAC
RAIDLQGSLAQAWQDLGAAGVARVMSADLLSGQG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggacaccacgctccgacctgacgattgcctgctggtgatcgacgtgcagaacgacttc
atgccgggcggcgcgcttgccgtgcccaacggcgacgaggtggtgcccgtcatcaaccgg
ctggcgcgggcgttcgggcacgtggtgctgacgcaggactggcatccggccgcgcacgtc
tcgttcgcggccaaccatgccggcacgcagccgttccagatgctgacgctgccgtatggc
gagcaggtgctgtggccggtgcactgcgtgcaggacacgcccggcgccgcgctgcatgcg
gggctgcacgtgccgcacgcgcggctgctgatccgcaagggccaccatgccggcgtggac
agctactccgcctttatggaagcggaccgcatcacgcgcaccggcctggccggctacctg
cgcgagcatggcgtgcagcgcgtgttctgcgccgggctggcgacggactactgcgtggcc
tggagcgcgctcgatgcgcgcgccgcgggcttcgaggccgcggtggtcgaggatgcgtgc
cgggccatcgacctgcaagggtcgctggcacaggcatggcaggacctcggcgccgccggc
gtcgcgcgcgtgatgtccgccgacctgctcagcggccagggctga

DBGET integrated database retrieval system