KEGG   Cupriavidus taiwanensis: RALTA_A1468Help
Entry
RALTA_A1468       CDS       T00702                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19 3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cti  Cupriavidus taiwanensis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:cti00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1527103..1527747
Genome map
AA seq 214 aa AA seqDB search
MDTTLRPDDCLLVIDVQNDFMPGGALAVPNGDEVVPVINRLARAFGHVVLTQDWHPAAHV
SFAANHAGTQPFQMLTLPYGEQVLWPVHCVQDTPGAALHAGLHVPHARLLIRKGHHAGVD
SYSAFMEADRITRTGLAGYLREHGVQRVFCAGLATDYCVAWSALDARAAGFEAAVVEDAC
RAIDLQGSLAQAWQDLGAAGVARVMSADLLSGQG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggacaccacgctccgacctgacgattgcctgctggtgatcgacgtgcagaacgacttc
atgccgggcggcgcgcttgccgtgcccaacggcgacgaggtggtgcccgtcatcaaccgg
ctggcgcgggcgttcgggcacgtggtgctgacgcaggactggcatccggccgcgcacgtc
tcgttcgcggccaaccatgccggcacgcagccgttccagatgctgacgctgccgtatggc
gagcaggtgctgtggccggtgcactgcgtgcaggacacgcccggcgccgcgctgcatgcg
gggctgcacgtgccgcacgcgcggctgctgatccgcaagggccaccatgccggcgtggac
agctactccgcctttatggaagcggaccgcatcacgcgcaccggcctggccggctacctg
cgcgagcatggcgtgcagcgcgtgttctgcgccgggctggcgacggactactgcgtggcc
tggagcgcgctcgatgcgcgcgccgcgggcttcgaggccgcggtggtcgaggatgcgtgc
cgggccatcgacctgcaagggtcgctggcacaggcatggcaggacctcggcgccgccggc
gtcgcgcgcgtgatgtccgccgacctgctcagcggccagggctga

DBGET integrated database retrieval system