KEGG   Cupriavidus taiwanensis: RALTA_A1537Help
Entry
RALTA_A1537       CDS       T00702                                 

Definition
protein-l-isoaspartate(d-aspartate) o-methyltransferase; exported protein (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cti  Cupriavidus taiwanensis
Brite
Enzymes [BR:cti01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RALTA_A1537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1600913..1601665)
Genome map
AA seq 250 aa AA seqDB search
MQPSARHPCFALLAVAVAAMASAGLCRAADDARLKQRAEMVSEIAAIDAGAGVPNRNHGI
APGVLSVMGQVPRHEFVPDPQKPHAYENRPLPIGHGQTISQPYIVALMTDLLRVQPGDSV
LEIGTGSGYQAAVLSQLARAVYTIEIIEPLGRQACERLQRLAYRQVACKVGDGYYGWDEH
APYDAIVVTAAASHVPPPLIRQLKPGGRMVIPVGAQFLTQYLLLVEKSADGSVSTRQILP
VRFVPLVGKH
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgcagccgtccgcccgccatccctgctttgccttgctcgccgttgccgtcgcggccatg
gcctcggccgggctgtgccgcgcggccgacgatgcgcggctgaagcagcgtgctgagatg
gtcagcgagatcgcggccatcgacgcgggcgccggcgtcccgaaccgcaaccacggcatt
gcgccgggcgtcctgtcggtgatgggccaggtgccgcgccacgagttcgtgccggacccg
cagaagccgcacgcctacgagaaccggccgctgccgatcggccatggccagaccatttcg
cagccgtatatcgtggcgctgatgaccgacctgctgcgggtccagcctggcgacagcgtg
ctcgagatcggcaccgggtccggctaccaggccgcggtgctgagccagctggcgcgcgcg
gtctacaccatcgagatcatcgagccgctcgggcgccaggcctgcgagcgcctgcagcgg
ctggcctaccggcaggtggcgtgcaaggtgggcgacggctactacggctgggacgagcat
gcgccctatgacgccatcgtcgtcaccgccgcggccagccatgtgccgccgccgctgatc
cgccagctgaaaccgggcgggcgcatggtgatcccggtgggcgcgcagttcctgacgcag
tacctgctgctggtcgaaaaatccgcggacggcagcgtcagcacccggcagatcctgccg
gtgcgcttcgtgccgctggtcggcaagcactga

DBGET integrated database retrieval system