KEGG   Cupriavidus taiwanensis: RALTA_A1582Help
Entry
RALTA_A1582       CDS       T00702                                 

Gene name
caiD
Definition
(RefSeq) enoyl-CoA hydratase (EC:4.2.1.-)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cti  Cupriavidus taiwanensis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RALTA_A1582 (caiD)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RALTA_A1582 (caiD)
   00650 Butanoate metabolism
    RALTA_A1582 (caiD)
  Lipid metabolism
   00071 Fatty acid degradation
    RALTA_A1582 (caiD)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RALTA_A1582 (caiD)
   00310 Lysine degradation
    RALTA_A1582 (caiD)
   00360 Phenylalanine metabolism
    RALTA_A1582 (caiD)
   00380 Tryptophan metabolism
    RALTA_A1582 (caiD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RALTA_A1582 (caiD)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RALTA_A1582 (caiD)
   00281 Geraniol degradation
    RALTA_A1582 (caiD)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RALTA_A1582 (caiD)
   00627 Aminobenzoate degradation
    RALTA_A1582 (caiD)
   00930 Caprolactam degradation
    RALTA_A1582 (caiD)
Enzymes [BR:cti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RALTA_A1582 (caiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1655600..1656364
Genome map
AA seq 254 aa AA seqDB search
MSDTLLKEIRGNVMVLTINRPEARNAMDFETATAIAAALDELDARDDLSLAVLTGAGGTF
CSGMDLKGFLAGKRPSIPGRGFGGVTEQPPRKVLIAAVEGYALAGGFELVLACDLVVASR
AAKFGLPEVKRGLAAAAGGLIRLPRRVPYHVAMEYALTGDMLPAERAYDLGLVNRLTDAG
GALDAALQLAEAVGANGPLAIAASKQVVAQSGDWTREEMFIKQKPLIDPVFTSADAREGA
AAFAEKRKPVWTGK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataccctgctgaaggaaatccgcggcaacgtgatggtgctgaccatcaaccgt
cccgaggcccgcaatgcgatggacttcgagaccgccacggcgattgccgccgcgctggat
gaactcgatgcgcgcgatgacctgagcctggcggtgctgaccggtgccggcggcaccttc
tgctccggcatggacctgaagggcttcctggccggcaagcgccccagcattcccggccgc
ggcttcggcggcgtgaccgagcagccgccgcgcaaagtgctgattgccgcggtcgagggc
tatgcgctcgccggcggcttcgagctggtgctggcgtgcgacctggtggtggcttcgcgc
gcggcgaagttcggcctgcccgaggtcaagcgcggcctggccgccgcggccggcgggctg
atccgcctgccgcgccgcgtgccgtaccacgtggcgatggaatatgcgctgaccggcgac
atgctgccggccgagcgtgcctacgacctcggcctggtcaaccgcctgaccgatgccggc
ggcgcgctcgacgccgcgctgcagctggccgaagcggtcggcgccaacgggccgctggcg
attgccgccagcaagcaggtggtggcgcagtccggcgactggacccgcgaggaaatgttc
atcaagcagaagccgctgatcgacccggtcttcacttccgccgacgcgcgcgagggcgcc
gccgccttcgccgagaagcgcaagccggtgtggacgggcaagtga

DBGET integrated database retrieval system