KEGG   Cupriavidus taiwanensis: RALTA_A1705Help
Entry
RALTA_A1705       CDS       T00702                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cti  Cupriavidus taiwanensis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cti01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cti00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1800695..1801846
Genome map
AA seq 383 aa AA seqDB search
MNPTLALTEDLIRRRSVTPADEGCQAILETRLKAIGFDCEALVSGPDDFRVTNLWAVKRG
TQGKDGKLLVFAGHTDVVPTGPLEQWHSDPFAPTHRDGKLYGRGAADMKTSIAGFVVAVE
EFVKAHPAHAGSIGFLITSDEEGPAHDGTIKVVEALSARGERLDYCVIGEPTSVNALGDM
VKNGRRGSLSGKLTVKGIQCHIAYPHLGRNPIHDAAPALAELAAEVWDAGNEYFPPTSWQ
MSNIHGGTGATNVIPGHVTIDFNFRFSTASTPEGLKARVHAILDRHSLDYTLDWTLGGEP
FLTPRGELSEALSSAIKAETGFDTELSTTGGTSDGRFIARICPQVIEFGPPNASIHKIDE
HVEVRFIEPLKNVYRGVLERLIA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccaccctcgcccttaccgaagacctgatccgccgccgctccgtcacgcccgcc
gacgaaggctgccaggccatcctggaaacccgcctcaaggcaatcggcttcgactgcgaa
gcgctggtcagcgggccagacgacttccgcgtgaccaacctgtgggcggtgaagcgcggc
acgcagggcaaggacggcaagctgctggtgttcgccggtcataccgacgtggtgccgacc
ggcccgctggagcagtggcattccgacccgttcgcgccgacccaccgcgacggcaagctg
tacggccgcggcgcggccgacatgaagacctcgatcgccggcttcgtggtggcggtggaa
gaattcgtcaaggcccatcccgcgcatgccggctcgatcggcttcctgatcaccagcgac
gaggaaggcccggcgcacgacggcaccatcaaggtggtggaggcgctgtccgcgcgcggc
gagcgcctggactactgcgtgatcggcgagccgacctcggtcaacgcgctcggcgacatg
gtcaagaacggccgccgcggctcgctgtcgggcaagctcacggtgaagggcatccagtgc
catatcgcctacccgcacctgggccgcaacccgatccacgacgccgccccggcgctggcc
gaactggccgccgaagtgtgggacgcgggcaacgagtatttcccgcccaccagctggcag
atgtcgaacatccacggcggcaccggcgccaccaacgtgatcccgggccacgtcaccatc
gacttcaatttccgcttctcgacggccagcacgcccgagggcctgaaggcgcgcgtgcat
gccatcctcgatcgccacagccttgactacacgctcgactggaccctgggcggcgagccc
ttcctgacgccgcgcggcgagctgtccgaggcgctgtcgtcggcaatcaaggccgagacc
ggcttcgacaccgagctgtcgaccaccggcggcacctccgacgggcgctttatcgccagg
atctgcccccaggtgatcgagttcggcccgcccaacgccagcatccacaagatcgacgaa
cacgtcgaagtgcgctttatcgagccgctgaagaacgtgtaccgcggcgtgctggaacgc
ctgatcgcctga

DBGET integrated database retrieval system