KEGG   Cupriavidus taiwanensis: RALTA_A1766Help
Entry
RALTA_A1766       CDS       T00702                                 

Gene name
aceA1
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cti  Cupriavidus taiwanensis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RALTA_A1766 (aceA1)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RALTA_A1766 (aceA1)
Enzymes [BR:cti01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     RALTA_A1766 (aceA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1862463..1863758)
Genome map
AA seq 431 aa AA seqDB search
MNRQEQIQALQKDWDTNPRWKGIKRNFSAEDVVRLRGSVQVEHTLARRGAEKLWHLLHTE
PFVNSLGALTGNQAMQQVKAGLKAIYLSGWQVAGDANLAGEMYPDQSLYPANSVPQVVKR
INNTFQRADQIQWSEGTGDTDFFAPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFEDQ
LASVKKCGHMGGKVLVPTREAVAKLTAARLAADVSGVPTLVIARTDAEAADLLTSDIDDN
DKPFCTGERTVEGFYRVRNGLEQSISRALAYAEVADLVWCETGKPDLEFAKKFAEAVHAR
FPGKMLAYNCSPSFNWKKNLDDATIARFQRELGAMGYKFQFITLAGFHSLNYSMFNLAYG
YARNQMSAFVELQEAEFKAAEKGFTAVKHQREVGTGYFDAVTQTIEGGQSSTTALKGSTE
DEQFFEDKKVA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgccaagagcagatccaggccctgcagaaagactgggacaccaatccgcgttgg
aagggcatcaagcgtaatttctccgccgaagacgtggtgcgcctgcgtggttcggttcag
gtcgagcacacgctggcgcgccgcggtgccgaaaagctgtggcacctgctgcataccgaa
ccgttcgtcaattcgctgggtgcgctgaccggcaaccaggccatgcagcaggtcaaggcg
ggcctgaaggcgatctacctgtcgggctggcaggttgccggtgacgccaacctggctggc
gagatgtacccggatcagtcgctgtatccggccaactcggtgccgcaggtggtcaagcgc
atcaacaacaccttccagcgcgccgaccagatccagtggagcgaaggcacgggcgacacc
gacttcttcgccccgatcgtcgccgacgcggaagccggcttcggcggcgtgctgaatgcc
ttcgaattgatgaaggccatgatcgaggcgggcgccgccggcgtgcacttcgaggaccag
ctcgcctcggtgaagaagtgcggccacatgggcggcaaggtgctggtgccgacccgcgaa
gccgtcgccaagctgaccgccgcgcgcctggccgccgacgtctcgggcgtgccgaccctg
gtgatcgcccgcaccgacgcagaggccgccgacctgctcacctccgacatcgatgacaac
gacaagccgttctgcaccggcgagcgcaccgtcgaaggcttctaccgcgtccgcaacggc
ctggagcagtcgatctcgcgggcgctggcctacgccgaggtggccgacctggtgtggtgc
gaaaccggcaagccggacctggaattcgccaagaagtttgccgaagccgtgcacgccagg
ttcccgggcaagatgctggcctacaactgctcgccgtcgttcaactggaagaagaacctg
gacgacgccaccatcgccaggttccagcgcgagctgggcgcgatggggtacaagttccag
ttcatcacgctggccggcttccattcgctgaactactcgatgttcaacctggcctacggc
tacgcccgcaaccagatgagcgcgttcgtcgaactgcaggaagccgagttcaaggccgcc
gaaaagggttttaccgcggtcaagcaccagcgcgaggtcggtaccggctatttcgacgcc
gtgacccagaccatcgaaggcggccagtcgtcgacgaccgcgctgaagggttcgaccgaa
gacgagcaattcttcgaagacaagaaagtggcctga

DBGET integrated database retrieval system