KEGG   Cupriavidus taiwanensis: RALTA_A1809Help
Entry
RALTA_A1809       CDS       T00702                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cti  Cupriavidus taiwanensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RALTA_A1809 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RALTA_A1809 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RALTA_A1809 (thrC)
Enzymes [BR:cti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RALTA_A1809 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1907257..1908702)
Genome map
AA seq 481 aa AA seqDB search
MKYQSTRGHEMPQSFSEILLGGLAPDGGLYLPAQYPQVTADELEAWRKLPYADLAYEILR
KFCDDIPAEDLRALTRKTYTPEVYCNAREGDNTADITPLRTLGEEGGTKLQLLSLSNGPT
LAFKDMAMQLLGNLFEYALARAGQELNILGATSGDTGSAAEYAMRGKRGIRVFMLSPHRK
MSAFQTAQMFSLQDPNIFNIAIDGVFDDAQDIVKAVSNDHAFKARQKIGTVNSINWARVV
AQVVYYFKGWLLATDGPGQKVSFCVPSGNFGNVCAGHIARMMGLPIDKLVVATNENDVLD
EFFRTGAYRVRKSAETYHTSSPSMDISKASNFERFVFDLLGQDAGKLAALFRDVEEKGGF
DLSGTPEFDRIRQFGFVSGRSTHQDRLATIRDLSSRYGITIDTHTADGIKVAREHLRAGV
PMVVLETALPAKFADTIREALGHEPERPAKFEGIESLPQRFEVMPADAAQVKAYIARHTG
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaataccagtcgacccgcggccacgagatgccgcaatcgttttccgagatcttgctg
ggcggcctggcgccggacggcggcctgtacctgcccgcgcagtatccgcaggtcaccgcc
gacgagctggaagcgtggcgcaagctgccgtatgccgacctggcctacgagatcctgcgc
aagttctgcgacgacattccggccgaggacctgcgcgcgctgacgcgcaagacctatacg
ccggaggtgtactgcaacgcgcgcgagggcgacaacaccgccgacatcacgccgctgcgc
acgctgggcgaggagggtggcacgaagttgcagctgctgagcctgtccaatggcccgacg
ctggcgttcaaggacatggcgatgcagctgctcggcaacctgttcgagtacgcgctcgcc
cgtgccggccaggagctgaacatcctcggcgccacctccggcgacaccggcagcgctgcc
gaatacgcgatgcgcggcaagcgcggcatccgcgtgttcatgctgagcccgcaccgcaag
atgagcgcgttccagaccgcgcagatgttcagcctgcaggacccgaacatcttcaacatc
gccatcgacggcgtgtttgacgacgcccaggacatcgtcaaggcggtctcgaacgaccac
gccttcaaggcgcgccagaagatcggcacggtcaactcgatcaactgggcacgcgtggtg
gcccaggtggtgtactacttcaagggctggctgctggcaaccgacggtcccggccagaag
gtctcgttctgcgtgccgtcgggcaacttcggcaacgtctgcgccggccatatcgcgcgc
atgatgggcctgccgatcgacaagctggtggtggccaccaacgagaacgacgtgctcgac
gagttcttccgcaccggtgcctaccgcgtgcgcaagtcggccgagacttaccacacctcc
agccccagcatggacatctccaaggcctcgaacttcgagcgcttcgtgttcgacctgctg
ggccaggacgccggcaagctggcggcactgttccgcgacgtggaggaaaagggcggcttc
gacctgtcgggcacgccggaattcgaccgcatccgccagttcggctttgtctcgggccgc
agtacgcaccaggaccggctggcgaccatccgcgacctgtcgtcgcgctatggcatcacc
atcgatacccataccgccgacggcatcaaggtggcgcgcgagcacctccgcgccggcgtg
cctatggtggtgctggaaaccgcgctgcccgccaagttcgccgacaccatccgcgaggcg
ctgggccacgagccggagcgcccggcgaagttcgagggcatcgaaagcctgccgcagcgc
ttcgaggtcatgccggccgacgccgcgcaggtcaaggcctatatcgcccgccacaccggc
ctgtaa

DBGET integrated database retrieval system