KEGG   Cupriavidus taiwanensis: RALTA_A1869Help
Entry
RALTA_A1869       CDS       T00702                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cti  Cupriavidus taiwanensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RALTA_A1869 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RALTA_A1869 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    RALTA_A1869 (sucB)
Enzymes [BR:cti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RALTA_A1869 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1966925..1968175)
Genome map
AA seq 416 aa AA seqDB search
MAIVDVKVPQLSESVAEATMLNWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLSQI
VKNDGDTVVADEVIAKIDTEATAGAAAPAAAAPAPAAAAPAPAAAAAPAAAGAVAMPSAA
KLMAEAGLSAGQVAGTGKDGRITKGDVLGAAAAPAPAAKAAPAPAAKPALQQVSAPVDFA
ALGDRPEERVPMSRLRARIAERLLQSQATNAILTTFNEVNMKPVMDLRNKYKDRFEKEHG
VKLGFMSFFVKAAVHALKKFPLINASIDGNDIVYHGYFDIGIAVGSPRGLVVPILRNADQ
MSLADIEKKIAEFGVKARDGKLSLEELSGGTFSISNGGVFGSMLSTPIINPPQSAILGVH
ATKDRPVVEDGQIVIRPMNYLAMSYDHRIIDGREAVLGLVAMKDALEDPARLLLDL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgttgacgtcaaggttccgcaactctccgaatcggtcgccgaagcgaccatg
ctcaactggaagaagaagcccggcgaagccgttgcccaggacgagatcctgatcgaaatc
gagaccgataaggtcgtgctggaagtgccggccccgtcggccggtgtgctgtcgcagatc
gtcaagaacgacggcgacaccgtcgtggccgatgaagtcatcgccaagatcgacaccgaa
gccaccgctggcgccgccgcccccgccgccgctgctccggctccggccgcagctgcaccg
gccccggccgctgctgccgcgccggccgccgccggcgccgtggcgatgccgtcggccgcc
aagctgatggccgaagccggcctgtcggctggccaggttgccggtaccggcaaggacggc
cgcatcaccaagggcgacgtgctgggcgcggccgccgcgccggcccccgccgccaaggcc
gctccggccccggccgccaagccggccctgcagcaggtttcggccccggtcgacttcgcc
gccctgggcgaccgcccggaagagcgcgtgccgatgagccgcctgcgtgcccgtatcgcc
gagcgcctgctgcagtcgcaagccaccaacgccatcctcaccaccttcaatgaagtgaac
atgaagccggtgatggacctgcgcaacaagtacaaggaccgcttcgagaaggaacacggc
gtgaagctgggcttcatgtcgttcttcgtcaaggccgcggtgcatgcgctgaagaagttc
ccgctgatcaacgcctcgatcgacggcaacgacatcgtctaccacggctacttcgacatc
ggtatcgctgtcggttcgccgcgcggcctggtggtgccgatcctgcgcaacgccgaccag
atgagcctggccgacatcgagaagaagatcgccgagttcggcgtcaaggcccgtgacggc
aagctgtcgctggaagagctgagcggcggtaccttctcgatctccaacggcggcgtgttc
ggctcgatgctgtcgaccccgatcatcaacccgccgcaatcggccatcctgggcgtgcac
gccaccaaggaccgcccggtggtggaagacggccagatcgtgatccgtccgatgaactac
ctggccatgtcctacgaccaccgcatcatcgacggccgcgaagccgtgctgggcctggtc
gccatgaaggacgcactggaagatccggcgcgcctgctgctggacctgtaa

DBGET integrated database retrieval system