KEGG   Cupriavidus taiwanensis: RALTA_A1920Help
Entry
RALTA_A1920       CDS       T00702                                 

Gene name
pcm1
Definition
protein-l-isoaspartate o-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cti  Cupriavidus taiwanensis
Brite
Enzymes [BR:cti01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     RALTA_A1920 (pcm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2026169..2027089)
Genome map
AA seq 306 aa AA seqDB search
MSSTPPRNKFPLPLDAVVERKPAPARTAGMPAVGAPRPAAPASKTATPAKPRLPRTAAPA
PVPVPASAVEQRASAATAGGGGMASARARAALAARLRAAGIRDERVLSAIATVPRHLFVE
PGLASQAYEDAALPIGHQQTISKPSVVARMIELLRAGLGADAPLERVLEIGTGCGYQAAV
LAQVARDVFSIERIRSLHEQAKANLRPLRVPNLRLHYGDGMLGLPQAAPFSAIILAAAGM
EVPEALLEQLAIGGRLIAPVAVVPPAGVPGQTVTQQLLLIERRNRHRFHRTALEAVFFVP
LKSGTI
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagttccacgccccctcgcaacaaattcccgctgccgctggatgcggtggtcgagcgc
aagcccgcgcctgcccgtaccgccggcatgccggcggtaggcgcgccgcgcccggccgcg
cccgcgtccaagactgccacgccggccaagccgcgcctgccgcgcacggcggcgcccgcg
cccgtgccggtgcctgccagcgcggtcgaacagcgcgcctcggcggccaccgcgggcggc
ggcggcatggcctcggcgcgtgcccgcgcggcactggcggcgcggctgcgcgccgccggc
atccgcgacgagcgcgtgctgtcggccatcgccacggtgccgcgccacctgttcgtcgag
ccggggctggcgtcgcaggcgtatgaagacgcggcgctgccgatcggccaccagcagacc
atttccaagccgtcggtggtggcgcgcatgatcgagttgttgcgcgcgggcctcggcgcc
gatgcgccgctggagcgcgtgctcgagatcggcaccggctgcggctaccaggccgcggtg
ctggcccaggtggcgcgcgatgtcttctcgatcgagcgcatccggtcgctgcacgagcag
gccaaggcgaacctgcgccccttgcgcgtgcccaatctgcgcctgcactacggcgacggc
atgctgggcctgccgcaggccgcgccgttctcggccatcatcctcgccgcggccggcatg
gaggtccccgaagcgctgctggagcagctggccatcggcgggcgcctgatcgccccggtg
gcggtggtgccgccggcgggcgtgcccggccagaccgtgacgcagcaactgctgctgatc
gagcggcgcaaccgccatcgctttcaccgaaccgcgcttgaagccgttttctttgtgccc
ttaaaatcgggcaccatctga

DBGET integrated database retrieval system