KEGG   Cupriavidus taiwanensis: RALTA_A1933Help
Entry
RALTA_A1933       CDS       T00702                                 

Gene name
recR
Definition
recombination protein recr
Orthology
K06187  
recombination protein RecR
Organism
cti  Cupriavidus taiwanensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cti03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2040117..2040731)
Genome map
AA seq 204 aa AA seqDB search
MKASSPTSLQALVEALRVLPGVGPKSAQRMAYHLLQHDREGARKLGDALRGAADHIRHCQ
RCNTFTEQEICETCLDDRRDASVLCVVETPADQVMIEQTLTYRGKYFVLMGRLSPLDGIG
PREIHLDRLLARATEPELGGPVGEVIVATNFTSEGEATAHYIGEMLKARGLKVSRLARGV
PVGGELEYVDAGTIARAVMDRRNL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcgtcgtcgccgacttcgctgcaggcgctggtcgaggcgctgcgggtgctgccc
ggcgtcgggcccaagtccgcccagcgcatggcctaccacctgctgcagcacgaccgcgag
ggcgcgcgcaagctgggcgacgcgctgcgcggcgcggcggaccatatccgccactgccag
cgctgcaataccttcaccgagcaggagatctgcgagacctgcctggacgaccgacgcgac
gcgtcggtgctgtgcgtggtcgaaacgccggccgaccaggtcatgatcgagcagacgctg
acctaccgcggcaagtatttcgtgctgatgggccggctttcgccgctggacggcatcggc
ccgcgcgagatccacctggaccggcttttggcgcgcgccaccgagcctgagctgggcggc
ccggtcggcgaagtcatcgtcgccaccaatttcaccagcgaaggcgaggccaccgcgcac
tacatcggcgagatgctcaaggcgcgcgggctcaaggtgtcgcgcctggcgcgcggcgtg
ccggtgggcggcgagctggagtatgtcgacgccggcaccatcgcgcgcgcggtgatggac
cgccgcaacctctga

DBGET integrated database retrieval system