KEGG   Cupriavidus taiwanensis: RALTA_A1933Help
Entry
RALTA_A1933       CDS       T00702                                 

Gene name
recR
Definition
(RefSeq) recombination protein recr
  KO
K06187  
recombination protein RecR
Organism
cti  Cupriavidus taiwanensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cti00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RALTA_A1933 (recR)
DNA repair and recombination proteins [BR:cti03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      RALTA_A1933 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2040117..2040731)
Genome map
AA seq 204 aa AA seqDB search
MKASSPTSLQALVEALRVLPGVGPKSAQRMAYHLLQHDREGARKLGDALRGAADHIRHCQ
RCNTFTEQEICETCLDDRRDASVLCVVETPADQVMIEQTLTYRGKYFVLMGRLSPLDGIG
PREIHLDRLLARATEPELGGPVGEVIVATNFTSEGEATAHYIGEMLKARGLKVSRLARGV
PVGGELEYVDAGTIARAVMDRRNL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcgtcgtcgccgacttcgctgcaggcgctggtcgaggcgctgcgggtgctgccc
ggcgtcgggcccaagtccgcccagcgcatggcctaccacctgctgcagcacgaccgcgag
ggcgcgcgcaagctgggcgacgcgctgcgcggcgcggcggaccatatccgccactgccag
cgctgcaataccttcaccgagcaggagatctgcgagacctgcctggacgaccgacgcgac
gcgtcggtgctgtgcgtggtcgaaacgccggccgaccaggtcatgatcgagcagacgctg
acctaccgcggcaagtatttcgtgctgatgggccggctttcgccgctggacggcatcggc
ccgcgcgagatccacctggaccggcttttggcgcgcgccaccgagcctgagctgggcggc
ccggtcggcgaagtcatcgtcgccaccaatttcaccagcgaaggcgaggccaccgcgcac
tacatcggcgagatgctcaaggcgcgcgggctcaaggtgtcgcgcctggcgcgcggcgtg
ccggtgggcggcgagctggagtatgtcgacgccggcaccatcgcgcgcgcggtgatggac
cgccgcaacctctga

DBGET integrated database retrieval system