KEGG   Cupriavidus taiwanensis: RALTA_A2010Help
Entry
RALTA_A2010       CDS       T00702                                 

Gene name
glpK
Definition
glycerol kinase (ATP:glycerol 3-phosphotransferase) (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cti  Cupriavidus taiwanensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    RALTA_A2010 (glpK)
Enzymes [BR:cti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     RALTA_A2010 (glpK)
Exosome [BR:cti04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RALTA_A2010 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2136811..2138382
Genome map
AA seq 523 aa AA seqDB search
MNQPAAQDQRPAPSQLPAKPQYVLALDQGTSSSRAILFDHAGNVVRLAQREFRQYYPHPG
HVEHDPYEIWQSQLAVAHTVLAEAGISASQVRAIGITNQRETTVLWDRKTGEPVGRALVW
QDRRTAPMCEALQAAGHGELFREKTGLVIDAYFSGTKLRWMLDNIEGARERAQRGELAFG
TVDSWLIWQLTDGARHVTDVSNASRTMLFNIHSFEWDDALLALLDIPHALLPEVVASSGE
VARTSARLFGMPIPIAGIAGDQQAATFGQACLVPGMAKNTYGTGCFLLMNTGAQPVTSRN
RLLTTIGWQYRGQTQYCLEGGVFMGGATIQWLRDGLKIIQSAPEAEALARQCDDSGGVVL
VPAFAGLGAPHWDAFARGTLVGMTRGTGRPQIARAALESIALQSVDVLEAMQKDAGIALA
ELRVDGGASRSDLLMQMQADLLGTPVVRPRVTETTALGAAYLAGLATGYWSDPVQIAQQW
QVERRFEPNLSADERGHRLARWHRAVARARDWAREDDAGAGPG
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagccagccgcgcaggaccagcgccctgccccgtcccagcttcccgccaagccc
caatacgtgctggcgctcgaccagggcaccagcagctcgcgggccatcctgttcgaccat
gccggcaacgtggtgcgcctggcgcagcgcgagttccgccaatattacccacatcccggc
cacgtcgagcacgatccctacgagatctggcagtcgcagctggcggtggcgcacacggtg
ctggccgaagccggcatcagcgcgtcgcaggtgcgcgccatcggcatcaccaaccagcgc
gagaccaccgtgctgtgggaccgcaagaccggcgagccggtcggccgcgcgctggtctgg
caggaccgccgcaccgcgccgatgtgcgaggcgctgcaggccgccggccacggcgagctg
ttccgcgagaagaccggcctggtcatcgacgcctatttttccggcaccaagctgcgctgg
atgctggacaacatcgaaggcgcgcgggagcgcgcgcagcgcggcgaactggccttcggc
accgtcgacagctggctgatctggcaactgaccgacggcgcgcgccatgtcaccgatgtc
tccaatgcctcgcgcacgatgctgttcaacatccacagcttcgaatgggacgacgcgctg
ctggcgctgctcgacatcccgcacgcgctgctgcccgaagtggtcgcctccagcggcgag
gtcgcgcggacctcggcgcggctgttcggcatgccgatcccgatcgccggcatcgccggc
gaccagcaggccgccaccttcggccaggcctgcctggtgccgggcatggccaagaacacc
tacggcaccggctgcttcctgctgatgaataccggcgcgcagccggtcacgtcgcgcaac
cggctgctgaccaccatcggctggcagtaccgcggccagacccagtattgcctggagggc
ggcgtgttcatgggcggcgccaccatccagtggctgcgcgacggcctgaagatcatccag
agcgcgcccgaggccgaggcgctggcgcgccagtgcgacgacagcggcggcgtggtgctg
gtgccggcctttgccgggctgggcgcgccgcactgggacgcctttgcgcgcggcacgctg
gtcggcatgacgcgcggcaccggccggccgcagatcgcgcgggcggcgctggaatcgatc
gcgctgcaaagcgtggacgtgctcgaggccatgcagaaggacgcgggcatcgcgctggcc
gagctgcgcgtggacggcggcgcgtcgcgcagcgacctgctgatgcagatgcaggccgac
ctgctcggcaccccggtggtacggccgcgcgtgaccgagaccacggcgctgggcgccgct
tacctggccggcctggccaccggctactggagcgatccggtgcagatcgcgcagcaatgg
caggtggagcggcgcttcgagcccaacctgtcggccgacgagcgcggccaccggctcgcg
cgctggcaccgggccgtcgcgcgcgcgcgcgactgggcccgcgaggacgatgccggcgcc
ggccccggctga

DBGET integrated database retrieval system