KEGG   Cupriavidus taiwanensis: RALTA_A2010Help
Entry
RALTA_A2010       CDS       T00702                                 

Gene name
glpK
Definition
glycerol kinase (ATP:glycerol 3-phosphotransferase) (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cti  Cupriavidus taiwanensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cti00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2136811..2138382
Genome map
AA seq 523 aa AA seqDB search
MNQPAAQDQRPAPSQLPAKPQYVLALDQGTSSSRAILFDHAGNVVRLAQREFRQYYPHPG
HVEHDPYEIWQSQLAVAHTVLAEAGISASQVRAIGITNQRETTVLWDRKTGEPVGRALVW
QDRRTAPMCEALQAAGHGELFREKTGLVIDAYFSGTKLRWMLDNIEGARERAQRGELAFG
TVDSWLIWQLTDGARHVTDVSNASRTMLFNIHSFEWDDALLALLDIPHALLPEVVASSGE
VARTSARLFGMPIPIAGIAGDQQAATFGQACLVPGMAKNTYGTGCFLLMNTGAQPVTSRN
RLLTTIGWQYRGQTQYCLEGGVFMGGATIQWLRDGLKIIQSAPEAEALARQCDDSGGVVL
VPAFAGLGAPHWDAFARGTLVGMTRGTGRPQIARAALESIALQSVDVLEAMQKDAGIALA
ELRVDGGASRSDLLMQMQADLLGTPVVRPRVTETTALGAAYLAGLATGYWSDPVQIAQQW
QVERRFEPNLSADERGHRLARWHRAVARARDWAREDDAGAGPG
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagccagccgcgcaggaccagcgccctgccccgtcccagcttcccgccaagccc
caatacgtgctggcgctcgaccagggcaccagcagctcgcgggccatcctgttcgaccat
gccggcaacgtggtgcgcctggcgcagcgcgagttccgccaatattacccacatcccggc
cacgtcgagcacgatccctacgagatctggcagtcgcagctggcggtggcgcacacggtg
ctggccgaagccggcatcagcgcgtcgcaggtgcgcgccatcggcatcaccaaccagcgc
gagaccaccgtgctgtgggaccgcaagaccggcgagccggtcggccgcgcgctggtctgg
caggaccgccgcaccgcgccgatgtgcgaggcgctgcaggccgccggccacggcgagctg
ttccgcgagaagaccggcctggtcatcgacgcctatttttccggcaccaagctgcgctgg
atgctggacaacatcgaaggcgcgcgggagcgcgcgcagcgcggcgaactggccttcggc
accgtcgacagctggctgatctggcaactgaccgacggcgcgcgccatgtcaccgatgtc
tccaatgcctcgcgcacgatgctgttcaacatccacagcttcgaatgggacgacgcgctg
ctggcgctgctcgacatcccgcacgcgctgctgcccgaagtggtcgcctccagcggcgag
gtcgcgcggacctcggcgcggctgttcggcatgccgatcccgatcgccggcatcgccggc
gaccagcaggccgccaccttcggccaggcctgcctggtgccgggcatggccaagaacacc
tacggcaccggctgcttcctgctgatgaataccggcgcgcagccggtcacgtcgcgcaac
cggctgctgaccaccatcggctggcagtaccgcggccagacccagtattgcctggagggc
ggcgtgttcatgggcggcgccaccatccagtggctgcgcgacggcctgaagatcatccag
agcgcgcccgaggccgaggcgctggcgcgccagtgcgacgacagcggcggcgtggtgctg
gtgccggcctttgccgggctgggcgcgccgcactgggacgcctttgcgcgcggcacgctg
gtcggcatgacgcgcggcaccggccggccgcagatcgcgcgggcggcgctggaatcgatc
gcgctgcaaagcgtggacgtgctcgaggccatgcagaaggacgcgggcatcgcgctggcc
gagctgcgcgtggacggcggcgcgtcgcgcagcgacctgctgatgcagatgcaggccgac
ctgctcggcaccccggtggtacggccgcgcgtgaccgagaccacggcgctgggcgccgct
tacctggccggcctggccaccggctactggagcgatccggtgcagatcgcgcagcaatgg
caggtggagcggcgcttcgagcccaacctgtcggccgacgagcgcggccaccggctcgcg
cgctggcaccgggccgtcgcgcgcgcgcgcgactgggcccgcgaggacgatgccggcgcc
ggccccggctga

DBGET integrated database retrieval system