KEGG   Cupriavidus taiwanensis: RALTA_A2051Help
Entry
RALTA_A2051       CDS       T00702                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cti  Cupriavidus taiwanensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cti00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:cti00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2175313..2176380)
Genome map
AA seq 355 aa AA seqDB search
MNPTPSMSKKNSGKRPGPVVLDVVGKQLDAEDARRIAHPLTGGVILFARNFESRAQLEAL
TRAIRAVRDDVLICIDHEGGRVQRCKTDGFTHLPAMHRLGELWERDVLAATKAAVACGYV
LAAELRACDIDLSFTPVLDLDYGRSAVIGDRAFHADPRVVSMLAGHLNHGLLLAGMSNCG
KHFPGHGYVEADSHVAIPVDERTLDEILGQDARPYEWLGLSLASVMPAHVIYPKVDPSPA
GFSRYWLQDVLRAQLGFEGVIFSDDLSMEGASVAGNVTEAARAALTAGCDMVLICNHPDR
ADQLLSELDVDIDKMSRRRIRKLFARRKPLDWNKLHQQGEYRAALRTLQEHDLIA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgaacccaaccccttccatgtccaagaagaattccggcaagcggccgggcccggtggtc
ctcgatgtcgtcggcaagcagctcgacgcggaagacgcgcgccgcatcgcgcatccgctc
accggcggcgtgatcctgttcgcgcgcaatttcgagtcgcgcgcgcagctggaggcgctg
acgcgtgccatccgcgcggtgcgcgacgacgtgctgatctgcatcgaccatgaaggcggt
cgcgtgcagcgctgcaagaccgatggcttcacccacctgccggcgatgcaccgcctgggc
gagctgtgggaacgcgacgtgctggccgcgaccaaggcggcggttgcctgtggctatgtg
ctggccgccgagctgcgcgcctgcgatatcgacctgagcttcaccccggtgctggacctc
gactacggccgcagcgccgtgatcggcgatcgcgccttccacgccgatccgcgcgtggtg
tcgatgctggccggccacctgaaccacggcctgctgctggccggcatgagcaactgcggc
aagcactttcccggccacggctacgtcgaggcggattcgcacgtggcgatcccggtcgac
gagcgcacgctggacgagatcctcggccaggacgcgcgcccgtatgaatggctgggcctg
tcgctggcgtcggtgatgccggcgcacgtgatctaccccaaggtcgatcccagcccggcg
ggcttctcgcgctactggctgcaggacgtgctgcgcgcacaactgggcttcgagggtgtg
atcttcagcgacgacctgagcatggaaggtgccagcgtcgccggcaacgtcaccgaggcc
gcgcgtgccgcgctgaccgccggctgcgacatggtgctgatctgcaaccacccggaccgt
gccgaccagctcctgagcgagctcgacgtggatatcgacaagatgtcgcgtcgccgcatc
cgcaagctgttcgcgcgacgcaagccgctggactggaacaagctgcaccagcagggcgag
taccgcgccgcgctgcgcacgctgcaggaacacgacctgatcgcctga

DBGET integrated database retrieval system