KEGG   Cupriavidus taiwanensis: RALTA_A2051Help
Entry
RALTA_A2051       CDS       T00702                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cti  Cupriavidus taiwanensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RALTA_A2051 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    RALTA_A2051 (nagZ)
Enzymes [BR:cti01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RALTA_A2051 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2175313..2176380)
Genome map
AA seq 355 aa AA seqDB search
MNPTPSMSKKNSGKRPGPVVLDVVGKQLDAEDARRIAHPLTGGVILFARNFESRAQLEAL
TRAIRAVRDDVLICIDHEGGRVQRCKTDGFTHLPAMHRLGELWERDVLAATKAAVACGYV
LAAELRACDIDLSFTPVLDLDYGRSAVIGDRAFHADPRVVSMLAGHLNHGLLLAGMSNCG
KHFPGHGYVEADSHVAIPVDERTLDEILGQDARPYEWLGLSLASVMPAHVIYPKVDPSPA
GFSRYWLQDVLRAQLGFEGVIFSDDLSMEGASVAGNVTEAARAALTAGCDMVLICNHPDR
ADQLLSELDVDIDKMSRRRIRKLFARRKPLDWNKLHQQGEYRAALRTLQEHDLIA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgaacccaaccccttccatgtccaagaagaattccggcaagcggccgggcccggtggtc
ctcgatgtcgtcggcaagcagctcgacgcggaagacgcgcgccgcatcgcgcatccgctc
accggcggcgtgatcctgttcgcgcgcaatttcgagtcgcgcgcgcagctggaggcgctg
acgcgtgccatccgcgcggtgcgcgacgacgtgctgatctgcatcgaccatgaaggcggt
cgcgtgcagcgctgcaagaccgatggcttcacccacctgccggcgatgcaccgcctgggc
gagctgtgggaacgcgacgtgctggccgcgaccaaggcggcggttgcctgtggctatgtg
ctggccgccgagctgcgcgcctgcgatatcgacctgagcttcaccccggtgctggacctc
gactacggccgcagcgccgtgatcggcgatcgcgccttccacgccgatccgcgcgtggtg
tcgatgctggccggccacctgaaccacggcctgctgctggccggcatgagcaactgcggc
aagcactttcccggccacggctacgtcgaggcggattcgcacgtggcgatcccggtcgac
gagcgcacgctggacgagatcctcggccaggacgcgcgcccgtatgaatggctgggcctg
tcgctggcgtcggtgatgccggcgcacgtgatctaccccaaggtcgatcccagcccggcg
ggcttctcgcgctactggctgcaggacgtgctgcgcgcacaactgggcttcgagggtgtg
atcttcagcgacgacctgagcatggaaggtgccagcgtcgccggcaacgtcaccgaggcc
gcgcgtgccgcgctgaccgccggctgcgacatggtgctgatctgcaaccacccggaccgt
gccgaccagctcctgagcgagctcgacgtggatatcgacaagatgtcgcgtcgccgcatc
cgcaagctgttcgcgcgacgcaagccgctggactggaacaagctgcaccagcagggcgag
taccgcgccgcgctgcgcacgctgcaggaacacgacctgatcgcctga

DBGET integrated database retrieval system