KEGG   Cupriavidus taiwanensis: RALTA_A2110Help
Entry
RALTA_A2110       CDS       T00702                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cti  Cupriavidus taiwanensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RALTA_A2110 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RALTA_A2110 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RALTA_A2110 (trpA)
Enzymes [BR:cti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RALTA_A2110 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(2231294..2232091)
Genome map
AA seq 265 aa AA seqDB search
MSRIQKTFAALAAQQKKGLIPFITAGDPEPGLTVALMHALVAGGADVIELGVPFSDPMAD
GPVIQRASERALAQGVSLTQVLQWVREFRQTNTDTPVVLMGYANPIERMGEAAFAAAASA
AGVDGVLVVDYPPEECESFAGLMRDHGMDPIFLLAPTSTDARIEAVAKVASGYLYYVSLK
GVTGSASIDLDSVAARLPLIKQHANLPVGVGFGIRDAQTARAIGSVADAVVIGSRLVQLL
EDTPREQAVTALQSFIAEIRQALDA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtatccagaagacgttcgcggcactggccgcgcagcagaagaagggcctgatt
ccgttcatcaccgccggcgatccggagcccggcctgaccgtggcgctgatgcacgcgctg
gtggccggcggcgccgacgtgatcgagctgggcgtgccgttctccgacccgatggccgac
ggcccggtgatccagcgcgcctccgagcgtgcgctggcgcagggcgtgtcgctcacgcag
gtgctgcagtgggtgcgcgagttccgccagaccaatacggatacgccggtggtgctgatg
ggctacgccaacccgatcgagcgcatgggcgaagcggcattcgccgcggccgcgagcgcc
gccggcgtcgacggcgtgctggtggtcgactatccgcccgaggagtgcgagtcgttcgcc
gggctgatgcgcgaccatggcatggacccgatcttcctgctggcgcccacctcgaccgat
gcgcgcatcgaggccgtggccaaggtcgccagcggctatctttactatgtctcgctcaag
ggcgtgaccggttccgcatcgatcgacctcgacagcgtggcggcgcgcctgccgctgatc
aagcagcacgccaacctgccggtaggggtgggcttcggcattcgcgacgcgcagaccgcg
cgcgcgatcggcagcgtggccgatgccgtggtgatcggcagccggctggtgcagctgctg
gaagacacgccgcgcgagcaggccgtgacggcgttgcaatcgtttatcgccgagattcgc
caggcgctggacgcttga

DBGET integrated database retrieval system