KEGG   Cupriavidus taiwanensis: RALTA_A2112Help
Entry
RALTA_A2112       CDS       T00702                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cti  Cupriavidus taiwanensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RALTA_A2112 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RALTA_A2112 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RALTA_A2112 (trpB)
Enzymes [BR:cti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RALTA_A2112 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(2233022..2234215)
Genome map
AA seq 397 aa AA seqDB search
MYDLPDSRGHFGPYGGTFVSETLVHALDELREAYAHYQKDPEFDAEFRRELKHFVGRPSP
IYHAQRWSETLGGAQIYFKREDLNHTGAHKINNVIGQALLARRMGKPRVIAETGAGQHGV
ATATIAARFGMECVVYMGAEDVKRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNVENTFYIIGTVAGPHPYPMMVRDFQCVIGEEAKVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIEHQDVQLIGVEAAGDGLDTGRHAASLTGGTPGVLHGNRTYLLQDDNGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVPITDEEALKAFHDCCRIEGIIPALESSHAIAY
ACKLAPTLPKDKLLLVNLSGRGDKDMHTVAERAGLKL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacctgcccgattcccgtggccatttcggcccctatggcggcaccttcgtttcc
gagacgctggtccacgcgcttgatgagctgcgcgaagcctatgcgcactaccagaaggac
ccggagttcgacgccgaattccgccgcgagctgaagcacttcgtcggccgcccgtcgccg
atctatcacgcgcagcgctggagcgagacgctcggcggcgcgcagatctacttcaagcgc
gaagacctgaaccacaccggcgcgcacaagatcaacaatgtcatcggccaggcgctgctg
gccaggcgcatgggcaagccgcgcgtgatcgccgagaccggggcagggcagcacggcgtg
gccaccgccaccatcgccgcgcgcttcggcatggagtgcgtggtctacatgggcgccgag
gacgtcaagcgccaggccgccaacgtctaccgcatgaagctgctgggcgcgaccgtggtg
ccggtggaaagcggctcgcgcacgctcaaggacgcgctcaacgaagccatgcgcgactgg
gtcaccaacgtcgagaacaccttttacatcatcggcaccgtggccggcccgcacccgtat
ccgatgatggtgcgcgacttccagtgcgtgatcggcgaggaggccaaggtgcagatgccc
gagctggccgggcgccagccggatgccgtgatcgcgtgcgtgggcggtggctccaatgcc
atgggcatcttctatccgtatatcgagcaccaggatgtgcagctgatcggcgtcgaagcc
gccggcgacgggctggacaccggccgccacgcggcgtcgctgaccggcggcacgcccggc
gtgctgcacggcaaccgcacttacctgctgcaggacgacaacggccagatcatcgagacg
cattcggtctcggccggcctggactaccccggcgtcggccccgagcatgcctggctcaag
gacagcggccgcgcgcagtacgtgccgatcaccgacgaggaagcgctcaaggccttccac
gactgctgccgcatcgagggcatcatcccggcgctggaatcgagccatgcgatcgcctac
gcctgcaagctggcgccgacgctgcccaaggacaagctgctgctggtgaacctgtccggc
cgcggtgacaaggacatgcacaccgtggccgagcgcgcggggctcaagctctga

DBGET integrated database retrieval system