KEGG   Cupriavidus taiwanensis: RALTA_A2195Help
Entry
RALTA_A2195       CDS       T00702                                 

Gene name
folA
Definition
(RefSeq) dihydrofolate reductase type I (EC:1.5.1.3)
  KO
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cti  Cupriavidus taiwanensis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RALTA_A2195 (folA)
   00670 One carbon pool by folate
    RALTA_A2195 (folA)
Enzymes [BR:cti01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     RALTA_A2195 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2326767..2327267
Genome map
AA seq 166 aa AA seqDB search
MTLLTLVVARARNGTIGRDNTLPWRLPEDLAHFKRTTMGAPVIMGRKTWDSIGRPLPGRR
NIVVSRNPDLRLEGAEVAPSLEDAQRLCVGAEQIFLIGGAQLYAEAMPSADRLVVTEIDA
DVEGDAFFPEIDRTQWIETARETHHSAANGFDYAFVTYERPPSQES
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgctgaccctggttgtagcccgcgcccgcaacggcaccatcggccgcgacaac
acgctgccgtggcgcctgcccgaagacctggcgcacttcaagcgcaccaccatgggcgcg
cccgtgatcatggggcgcaagacctgggattcgatcggccgcccgctgccggggcgccgc
aatatcgtggtcagccgcaaccccgacctgcgcctcgagggcgccgaggtggcaccgtcg
ctggaagacgcccagcgcctgtgcgtgggcgccgagcagatcttcctgatcggcggcgca
cagttgtatgccgaagccatgccgagcgcggaccggctggtggtgaccgagatcgatgcg
gacgtggagggcgacgcgtttttccccgagatcgaccgcacccagtggatcgaaaccgcg
cgcgagacccatcattcggcagcgaacggcttcgactacgccttcgtcacgtacgagcgg
ccgccttcgcaagaatcgtga

DBGET integrated database retrieval system