KEGG   Cupriavidus taiwanensis: RALTA_A2251Help
Entry
RALTA_A2251       CDS       T00702                                 

Gene name
galU1
Definition
(RefSeq) glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cti  Cupriavidus taiwanensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RALTA_A2251 (galU1)
   00052 Galactose metabolism
    RALTA_A2251 (galU1)
   00500 Starch and sucrose metabolism
    RALTA_A2251 (galU1)
   00520 Amino sugar and nucleotide sugar metabolism
    RALTA_A2251 (galU1)
Enzymes [BR:cti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RALTA_A2251 (galU1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2387200..2388120
Genome map
AA seq 306 aa AA seqDB search
MDWNLRGTPDMENRVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAG
ITEMIFVTGRSKRAIEDHFDKAFELEVELEAKNKQALLDVVRSIKPANVECYYVRQPEAL
GLGHAVLCAAKLVGDTPFAVMLADDLIDGNPPVMKQMVDAFNHYNCSVLGVEEITPEQSR
SYGVIDGREWDDDVIKVSGIVEKPAPEDAPSNLGVVGRYILTPRIFDHLRELKPGAGGEL
QLTDAIQSLLGQEQVLAYRYQGRRYDCGSKLGYLKATVEFALKHPEVGTDFSAYLESREH
LNGLGR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggactggaatctgagaggtacacctgatatggaaaatcgcgtcaccaaggctgtgttc
ccggttgcgggcctgggcacccgcttcctgccagccaccaaggccagccccaaggaaatg
cttccggtggtggacaagccgctgatccagtacgccgtggaagaagccatggccgccggc
attaccgagatgatcttcgtcacgggccgctccaaacgcgcgatcgaggaccatttcgac
aaggccttcgaactggaggtagagctcgaagccaagaacaagcaggcgctgctggacgtg
gtgcgctcgatcaagccggccaacgtggagtgctactacgtgcgccagcccgaggcactg
ggcctgggccatgccgtgctgtgcgcggccaagctggtgggcgacacgccgttcgcggtg
atgctggccgatgacctgatcgacggcaacccgccggtgatgaagcagatggtggatgcc
ttcaaccactacaactgctcggtgctgggcgtcgaggaaatcacgcccgagcagagccgc
tcctacggcgtgatcgacggccgcgagtgggacgacgacgtgatcaaggtctcgggcatc
gtcgagaagccggcgccggaagatgcaccgtcgaaccttggcgtggtcggccgttacatc
ctgacgccgcgcatcttcgaccaccttcgcgagctcaagcccggcgcgggcggcgaactg
cagctgaccgacgcgatccagtcgctgctgggccaggagcaggtgctggcgtaccgctac
cagggccgccgctatgactgcggcagcaagctgggctacctcaaggcgaccgtcgagttt
gcgctgaagcaccccgaagtgggtaccgatttcagcgcctacctggaatcgcgcgaacac
ctgaacggcctggggcgctga

DBGET integrated database retrieval system