KEGG   Cupriavidus taiwanensis: RALTA_A2251Help
Entry
RALTA_A2251       CDS       T00702                                 

Gene name
galU1
Definition
glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cti  Cupriavidus taiwanensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RALTA_A2251 (galU1)
   00052 Galactose metabolism
    RALTA_A2251 (galU1)
   00500 Starch and sucrose metabolism
    RALTA_A2251 (galU1)
   00520 Amino sugar and nucleotide sugar metabolism
    RALTA_A2251 (galU1)
Enzymes [BR:cti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RALTA_A2251 (galU1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2387200..2388120
Genome map
AA seq 306 aa AA seqDB search
MDWNLRGTPDMENRVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAG
ITEMIFVTGRSKRAIEDHFDKAFELEVELEAKNKQALLDVVRSIKPANVECYYVRQPEAL
GLGHAVLCAAKLVGDTPFAVMLADDLIDGNPPVMKQMVDAFNHYNCSVLGVEEITPEQSR
SYGVIDGREWDDDVIKVSGIVEKPAPEDAPSNLGVVGRYILTPRIFDHLRELKPGAGGEL
QLTDAIQSLLGQEQVLAYRYQGRRYDCGSKLGYLKATVEFALKHPEVGTDFSAYLESREH
LNGLGR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggactggaatctgagaggtacacctgatatggaaaatcgcgtcaccaaggctgtgttc
ccggttgcgggcctgggcacccgcttcctgccagccaccaaggccagccccaaggaaatg
cttccggtggtggacaagccgctgatccagtacgccgtggaagaagccatggccgccggc
attaccgagatgatcttcgtcacgggccgctccaaacgcgcgatcgaggaccatttcgac
aaggccttcgaactggaggtagagctcgaagccaagaacaagcaggcgctgctggacgtg
gtgcgctcgatcaagccggccaacgtggagtgctactacgtgcgccagcccgaggcactg
ggcctgggccatgccgtgctgtgcgcggccaagctggtgggcgacacgccgttcgcggtg
atgctggccgatgacctgatcgacggcaacccgccggtgatgaagcagatggtggatgcc
ttcaaccactacaactgctcggtgctgggcgtcgaggaaatcacgcccgagcagagccgc
tcctacggcgtgatcgacggccgcgagtgggacgacgacgtgatcaaggtctcgggcatc
gtcgagaagccggcgccggaagatgcaccgtcgaaccttggcgtggtcggccgttacatc
ctgacgccgcgcatcttcgaccaccttcgcgagctcaagcccggcgcgggcggcgaactg
cagctgaccgacgcgatccagtcgctgctgggccaggagcaggtgctggcgtaccgctac
cagggccgccgctatgactgcggcagcaagctgggctacctcaaggcgaccgtcgagttt
gcgctgaagcaccccgaagtgggtaccgatttcagcgcctacctggaatcgcgcgaacac
ctgaacggcctggggcgctga

DBGET integrated database retrieval system