KEGG   Cupriavidus taiwanensis: RALTA_A2364Help
Entry
RALTA_A2364       CDS       T00702                                 

Gene name
cpsG
Definition
(RefSeq) phosphomannomutase (EC:5.4.2.8)
  KO
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cti  Cupriavidus taiwanensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RALTA_A2364 (cpsG)
   00030 Pentose phosphate pathway
    RALTA_A2364 (cpsG)
   00051 Fructose and mannose metabolism
    RALTA_A2364 (cpsG)
   00052 Galactose metabolism
    RALTA_A2364 (cpsG)
   00500 Starch and sucrose metabolism
    RALTA_A2364 (cpsG)
   00520 Amino sugar and nucleotide sugar metabolism
    RALTA_A2364 (cpsG)
  Nucleotide metabolism
   00230 Purine metabolism
    RALTA_A2364 (cpsG)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RALTA_A2364 (cpsG)
Enzymes [BR:cti01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     RALTA_A2364 (cpsG)
    5.4.2.8  phosphomannomutase
     RALTA_A2364 (cpsG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2503990..2505375)
Genome map
AA seq 461 aa AA seqDB search
MRLDPSIFKAYDIRGIVGKTLTRDVARQIGLSFGSAAAEAGEKAVVVGRDGRLSGPDLIS
GLIEGLRASGMDVIDLGMVATPMVYLATNIELDGVAATSGIMVTGSHNPPDYNGFKMVLA
GKAIYGEQIKALHQRIEAGAFASGAGAYREVNVRQRYLDRILSDVKLSRPMKIALDAGNG
VAGAFVGDLFRGLGCEVTELFCEVDGNFPNHHPDPAHVENLQDLMRCLRETDCELGLAFD
GDGDRLGVVTKDGQVIFPDRQLMLFAEEILARNPGAQVIYDVKCTGKLAPWIRQHGGEPL
MWKTGHSLVKAKLKETGAPIAGEMSGHVFFKDRWYGFDDGLYTGARLLEILSRHADPSAV
LNALPNANNTPELQLKCAEGEPFTLLDKIKANASFDGAREVITIDGVRVEYADGFGLARP
SNTTPVVVMRFEADNDAALARIQAEFKRVILAEKPDAQLPF
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgagactcgatccctccatcttcaaagcctatgacatccgcggcatcgtcggtaagacg
cttactagggatgtggcccgccagatcggcctctcattcggttctgccgcggcggaagct
ggcgaaaaggctgtcgttgtcggccgcgacggccggctctctggccctgatctcatcagc
ggactgattgaaggcctccgggcctctggcatggacgtcatcgacctgggcatggtggcc
acgccgatggtctaccttgctacgaacatcgaactggacggcgtggccgcaacctcgggc
atcatggtcaccgggagccacaacccgccggactacaacgggttcaagatggttctggcg
ggcaaggctatctacggcgagcaaatcaaggcgctgcaccagcgcatcgaggccggcgcc
tttgcaagcggtgccggtgcgtatcgcgaggtgaatgtgcgtcagaggtatctcgaccgt
atcctgagcgatgtcaagctgtcccggcccatgaagattgcgctggatgccggcaatggc
gtcgccggtgccttcgtgggcgacctgttccgtgggctcggttgcgaggtaacggaactg
ttttgcgaagtcgacggtaatttcccgaaccatcatcccgaccccgctcatgtcgagaac
ctgcaggatctgatgcgatgcctgcgcgagacggattgcgaactgggcctcgctttcgat
ggcgatggcgaccggctgggtgttgtcaccaaggacgggcaggtgattttcccggaccgc
cagctgatgctgttcgccgaagaaatcctggcgcgcaatccgggggcgcaggtgatctac
gacgtcaagtgcaccggcaaactggcaccgtggatccggcagcatgggggcgagccgctg
atgtggaagaccggccattccctggtgaaggccaagctcaaggaaaccggcgcgccaatc
gccggcgagatgagcggacacgtgttcttcaaggatcgctggtatggctttgacgatggc
ctgtacacgggtgcccggctgctcgagatcctgtcgcgccacgccgatcccagcgcggtc
ctcaatgcgctgccgaacgccaacaacacgcccgagttgcagctgaagtgcgcagagggt
gagccgttcacgctgctcgacaagatcaaggccaacgccagcttcgacggcgcgcgcgag
gtcatcaccattgatggagttcgggtcgagtatgccgatggcttcggccttgcccgccct
tccaataccacgccggtggtggtgatgcgcttcgaggccgataacgatgccgcgctggca
cggattcaggctgagttcaaacgtgtgatcctggcagagaaaccggatgctcagctcccg
ttctga

DBGET integrated database retrieval system