KEGG   Cupriavidus taiwanensis: RALTA_A2401Help
Entry
RALTA_A2401       CDS       T00702                                 

Definition
bifunctional uroporphyrinogen-iii synthetase/uroporphyrin-iii c-methyltransferase (EC:2.1.1.107 4.2.1.75)
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cti  Cupriavidus taiwanensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RALTA_A2401
Enzymes [BR:cti01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     RALTA_A2401
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     RALTA_A2401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2539928..2542066)
Genome map
AA seq 712 aa AA seqDB search
MPRPTVVVTRPAGQSRQLTEALQGAGLDVLSFPLLAIGPAADDAPLRAALARLDTFALVV
FVSPNAIAFALDALAGVQGSAVARWPVPVAVAVVGPASVAALAERGIAAPAYRVIAPAGA
NANGAGHDDTVPDAEALRFDSEALWAQLDPAALAGKPVLIIRGNGGRDWLGDRLREAGAQ
VEAVEAYQRTLPEPGAMQWQAVRDHLRPGAAPHAWLLTSSEAVRNLDVLARQHLSPQEDA
ALRQVQCIAPHARIAEQALALGFAHIQRAAPGDAGLLAACLQWADAYAGPAPSSLPAPSA
PAAAKPAEVAAPPAASAPAAVPAMSTKVERVTQETTSSSATPPPGAASVHTAQSAQAAPP
QGAGHTGAARPAARRSAALWALVAVLVVATAGGFWWLQQRVDHLTGELARRQQSNDALVQ
ESRVLTRNAQDTVKELQAKVGALENQVGETRDKQVALEQVYQDLMRNRDDWEIAEIQQLL
TSAGQQLQLTGNVQVALAALQSADARLARADKPQYNLLRRAIARDVARMKAVPDTDLTGA
AIKLDEAINQVDALPLLSSERMLERSEADARKGAAAGSGNGASSPAAASGNGPGWFTRFW
DYLREELAQVIRIRKVDDAEALLLSGDQGWFLRENVKLRLLNARLALLSRNEPVFRNDLA
AAQAMIGRYFDTKSRRVQGVLTLLRQAQAGAVTVQLPTMAESLGALQALKKE
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcccgaccgtcgttgtcacacgacccgccgggcagtcccggcaactgaccgag
gccctgcagggcgccggtctggatgtactcagcttcccgctgctggcaatcggcccggcc
gctgacgatgcgccgctgcgcgcggcgctggcgcggctggacacctttgcgctggtggtg
ttcgtcagccccaatgccattgcctttgcgctggacgcgctcgccggcgtgcagggctcg
gccgtggcgcgctggccggtgccggtcgcggtggcggtggtcggccccgccagtgtcgcc
gcgctggccgagcgcggcatcgccgcgccggcgtatcgcgtgatcgcgccggcgggcgcc
aatgccaacggggccggccatgacgatacggtgcccgatgccgaggcgctgcgcttcgat
tccgaggcgctgtgggcacagctcgatcccgccgcgctggccggcaagccggtgctgatc
atccgtggcaacggcggacgcgactggctgggcgaccgcctgcgcgaggccggcgcccag
gtcgaggccgtcgaggcctaccagcgcacgctgcccgaacccggcgcgatgcaatggcag
gcggtgcgcgaccacctgcgtcccggcgccgcgccgcacgcctggctgctaaccagttcc
gaggcggtgcgcaaccttgacgtgctggcacggcagcatctgtcgccgcaggaagacgct
gcgctgcggcaggtgcagtgcatcgcgccccatgcgagaatcgccgaacaggcgctggcg
ctgggctttgcccatatccagcgtgccgcgcccggcgatgccggcctgctggcggcgtgc
ctgcagtgggccgatgcctatgccggtcctgcgccatcgagcctgccggcgccgtccgca
ccggcggccgcgaagccggccgaagtcgcagccccgccggccgccagcgcacctgccgca
gtccctgccatgtcaacgaaggtcgaacgcgtgacgcaagaaaccacgtcctcctccgct
acgccgccgcccggcgcggcctctgtccacacggcgcagtccgcgcaagcggccccgccg
caaggcgccggtcacaccggcgctgcgcgccccgccgcgcgccgctccgccgcgctatgg
gcgctggtcgccgtgctggtggtggcgaccgccggcggcttctggtggctgcagcagcgc
gtcgaccacctgaccggcgagctggcgcgccgccagcaaagcaacgacgccctggtgcag
gagtcgcgcgtgctgacacgcaacgcccaggacaccgtcaaggagctgcaggccaaggtc
ggcgcactggagaaccaggtcggcgaaacccgcgacaagcaggtggcgctggagcaggtc
taccaggacctgatgcgcaaccgcgacgactgggaaatcgccgagatccagcagctgctg
accagcgccggccagcagctgcagctgaccggcaacgtgcaggtcgcgctggccgcactg
caaagcgccgatgcgcgcctggcgcgcgccgacaagccgcaatacaacctgctgcgccgg
gccatcgcccgcgacgtggcgcgcatgaaggcggtgcccgacaccgacctgaccggcgcc
gcgatcaagctggacgaagccatcaaccaggtcgacgcgctgccgctgctgtccagcgaa
cgcatgctggagcgcagcgaggcggacgcgcgcaagggcgccgcggccggcagcggcaat
ggcgccagctcgccggccgccgccagcggcaacgggccgggctggttcacccgcttctgg
gactacctgcgcgaagagctggcgcaggtaatccgcatccgcaaggtcgacgatgccgag
gcgctgctgctctccggcgaccagggctggttcctgcgcgagaacgtcaagctgcgcctg
ctcaatgcgcgcctggcgctgctgtcgcgcaacgagcccgtgttccgcaacgacctggcc
gcggcgcaggcaatgatcggccgctatttcgataccaagtcgcgccgcgtgcagggtgtg
ctgacgctgctgcgccaggcgcaggctggcgcggtcacggtgcagttgccgaccatggcc
gaaagcctgggcgcgctgcaagccctgaagaaggagtaa

DBGET integrated database retrieval system