KEGG   Cupriavidus taiwanensis: RALTA_A2455Help
Entry
RALTA_A2455       CDS       T00702                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
cti  Cupriavidus taiwanensis
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cti00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:cti00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2602534..2603997)
Genome map
AA seq 487 aa AA seqDB search
MNSFDTGDQKISAPLGESEPSGSNILSRLGRWWGRKGEADARANGDARAATPADGETPLP
ARVVRRQREQLRLCFDARLTDGAANAAAQAWQAEYEAAGEATRRGMLAVLAEVASSGSEE
AAADGDKSARASRAQASQSNLGQALSNARIRFFKRLAALHGQRGNSACGLHFLIQLRADM
LRWQRRMPGLRPLDEDLEALFSNWFDVGLLELQPITWDSPASLLEKLIRYEAVHEIASWT
DLRNRLDSDRRCYAFFHPRIPREPLIFVEVAFAPEMAADVHTLLDEAAPLEDLRRVKWAI
FYSISNTQAGLRGVSFGNFLLKRVIEEVQREFPKVKQFATLSPIPGFADWLRKQDGETVA
RVLGDKRLARWNERHGSAPADGAAWLEALAPDAADAVVRDTALTLAAHFLVRERNQAMPA
DPVARFHLGNGACVERLNWGADLSRKGRSQSCGMMVNYLYVPEALDDNLARLGAGNPRIS
RSVGKLL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaactccttcgatacgggtgaccagaagatcagcgcgccactgggcgagagcgagccg
tcgggctccaatatcctgtcgcggctgggccgctggtgggggcgcaagggtgaggccgac
gccagggccaatggcgatgccagggccgccacgcctgccgatggcgagacgccgctgccg
gcgcgcgtggtgcgccgccagcgcgaacagctgcgcctgtgcttcgatgcgcgcctgacc
gacggcgccgccaacgccgccgcgcaggcctggcaggccgaatacgaggccgccggcgag
gccacgcggcgcggcatgctggccgtgctggccgaggtggcgagcagcggcagcgaagag
gccgctgccgacggcgacaagtccgcgcgcgcgagccgtgcgcaggccagccaatcgaac
ctgggccaggcgctgtccaacgcgcgcatccgcttcttcaagcggctggccgcactgcat
ggccagcgcggcaacagcgcctgcggcctgcacttcctgatccagctgcgcgccgacatg
ctgcgctggcagcgccgcatgccagggctgcgcccgctcgacgaagacctggaggccttg
ttctccaactggttcgacgtcggcctgctcgagcttcagccgattacctgggactcgccc
gcgtcgttgctggaaaagctgattcgctacgaagcggtgcacgagattgcctcgtggacc
gacctgcgcaaccggctcgattccgaccgccgctgctacgccttcttccacccgcgcatt
ccgcgcgagccgctgatcttcgtcgaggtagcctttgcccccgagatggcagccgacgtc
cataccctgctggacgaagccgcgccgctggaagacctgcgccgcgtcaagtgggcgatc
ttctattcgatcagcaatacgcaggcggggctgcgcggcgtcagcttcggcaacttcctg
ctcaagcgcgtgatcgaggaagtgcagcgcgaattcccgaaagtgaagcagttcgccacc
ctgtcgccgattcccggctttgccgactggctgcgcaagcaggacggcgagaccgtggcg
cgcgtgctgggcgacaagcggctggcgcgctggaacgagcggcacggcagcgcaccagcc
gacggcgcggcctggctggaggcgctggcgccggatgccgccgatgccgtggtgcgcgac
accgcgctgaccctggccgcgcacttcctggtgcgcgaacgcaaccaggctatgccggcc
gacccggtggcgcgcttccaccttggcaacggtgcctgcgtggagcggctcaactggggc
gccgacctgtcgcgcaagggccgcagccagagctgcggcatgatggtcaattacctttac
gtgcccgaggcgctggatgacaatctggcacgcctgggcgcaggcaacccgcgcatcagc
cgcagcgtcgggaagctgctgtga

DBGET integrated database retrieval system