KEGG   Cupriavidus taiwanensis: RALTA_A2557Help
Entry
RALTA_A2557       CDS       T00702                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cti  Cupriavidus taiwanensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RALTA_A2557 (folK)
Enzymes [BR:cti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     RALTA_A2557 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2709050..2709589
Genome map
AA seq 179 aa AA seqDB search
MTLAFIGIGANLGDARQAIKDAIVCLAQQVGITVLARSSLYRTAPVDAGGDDYYNAVVKV
QTSFTASQVLRICHHIEDQFGRERPFRNAPRTLDLDLLLFGDEQHDHEHLTVPHPRLTER
AFTLVPLLELDAALAIPGRGRAADYLAGVGAQRIEKVSTCKCLRLQAAAGEPDHGGTPG
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgactctcgccttcatcggcatcggcgcaaatcttggcgatgcccgccaggccatcaag
gacgccatcgtgtgcctggcccagcaggtcggcatcacggtgctggcgcgctcctcgctc
tatcgcaccgcgccggtcgatgccggcggcgacgactactacaacgcggtggtcaaggtg
cagacctcgttcaccgcttcgcaggtgctgcgcatctgccaccacatcgaagaccagttc
ggccgcgagcgcccgttccgcaacgcaccgcgcacgctggacctggacctgctgctgttc
ggcgacgaacagcatgaccacgagcacctgaccgtgccgcacccgcgcctgaccgagcgc
gccttcacgctggtgccgctgctggagctggacgccgcgctggcgatccccgggcgcggc
cgcgccgccgactacctggccggcgtgggcgcgcagcgcatcgagaaggtctccacctgc
aagtgcctgcgcctgcaggccgccgccggcgagcccgaccatggcggcacgcccggctaa

DBGET integrated database retrieval system