KEGG   Cupriavidus taiwanensis: RALTA_A2577Help
Entry
RALTA_A2577       CDS       T00702                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cti  Cupriavidus taiwanensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    RALTA_A2577
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RALTA_A2577
Enzymes [BR:cti01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RALTA_A2577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2729498..2729992)
Genome map
AA seq 164 aa AA seqDB search
MSNVYQFEASSLAGQPVPLSQFQGKVMLVVNTASECGFTPQYEGLQKLYDEYHGRGLEVL
GFPCNQFGKQEPGDAQQIGQFCETRFAVRFPMFAKIDVNGPNAHPLYQWLTTEKRGVLGT
QGIKWNFTKFLLRRDGTVFKRYAPTTKPEELRADIERLLSDPAA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgtctaccagttcgaagccagttcgctcgccggccagccggtgccgctgtcg
cagttccagggcaaggtgatgctggtggtcaataccgccagcgaatgcggctttaccccg
cagtacgagggcctgcagaaactctatgacgagtaccacgggcgcggcctggaggtgctg
ggcttcccgtgcaaccagttcggcaagcaggagccgggcgatgcgcagcagatcggccag
ttctgcgagacgcgtttcgcggtgcgcttcccgatgttcgccaagatcgacgtcaacggc
cccaacgcccatccgctgtaccagtggctgaccaccgaaaagcgtggcgtgctcggtacc
cagggcatcaagtggaacttcaccaagttcctgctgcgccgcgacggcaccgtgttcaag
cgctacgcgccgaccaccaagccggaagagctgcgcgccgatatcgagcggctgctgtcc
gaccccgctgcctga

DBGET integrated database retrieval system